diff --git a/.gitignore b/.gitignore
new file mode 100644
index 0000000..b14d66f
--- /dev/null
+++ b/.gitignore
@@ -0,0 +1,3 @@
+build/
+node_modules/
+**/*.params
\ No newline at end of file
diff --git a/README.md b/README.md
new file mode 100755
index 0000000..005e378
--- /dev/null
+++ b/README.md
@@ -0,0 +1,25 @@
+# EVzoom
+[EVzoom](https://marks.hms.harvard.edu/evzoom/) is an interactive, embeddable tool for visualizing [undirected graphical models](https://en.wikipedia.org/wiki/Markov_random_field) of protein families. Since these models explicitly parameterize all possible combinations of amino acids at all pairs of positions in a sequence, they contain far too much information to depict statically.
+
+EVzoom lets you zoom in on any pair of positions in a protein family and see both inferred couplings between amino acids and [sequence logos](https://en.wikipedia.org/wiki/Sequence_logo) that summarize conservation statistics.
+
+
+EVzoom is based on SVG and powered by [D3](https://d3js.org/).
+
+## Inference
+EVzoom is designed to be used with models inferred by [plmc](https://github.com/debbiemarkslab/plmc). The [examples](https://github.com/debbiemarkslab/plmc#examples) in the plmc repo show how to export JSON-formatted model files for EVzoom.
+
+Want to work directly with the couplings in an EVzoom visualization? Check out the [EVmutation](https://github.com/debbiemarkslab/EVmutation) Python package written by Thomas Hopf.
+
+## Embedding
+Embedding EVzoom takes two lines
+
+```html
+
+
+```
+
+The `data-couplings` tag specifies the URL for the json file. This tag can be overridden by appending a query string `?data=JSON_URL` to the URL. An example of the tag-based approach is available in `example/evzoom.html`. To take it for a spin and serve it from your filesystem, run `python -m SimpleHTTPServer 8000` in the root of the repository (requires Python 2.7) and navigate to `localhost:8000/example/evzoom.html` in your browser.
+
+## Author
+EVzoom was written by [John Ingraham](mailto:john.ingraham@gmail.com) in [Debora Marks' lab](https://marks.hms.harvard.edu/) at Harvard Medical School
diff --git a/data/dhfr.json b/data/dhfr.json
new file mode 100644
index 0000000..9dd0994
--- /dev/null
+++ b/data/dhfr.json
@@ -0,0 +1,811 @@
+{
+ "map": {
+ "letters": "LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSLVIMGKKTWFSIPRPLKGRINLVLSRELKEPPQGAFLSRSLDDALKLTEQVDMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPELSDVQEEKGIKYKFEVYEK",
+ "indices": [5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185]
+ },
+ "logo": [
+ [{"code":"M", "bits": 0.04},{"code":"F", "bits": 0.10},{"code":"V", "bits": 0.33},{"code":"L", "bits": 0.79},{"code":"I", "bits": 1.33}],
+ [{"code":"C", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"E", "bits": 0.01},{"code":"Q", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"I", "bits": 0.05},{"code":"K", "bits": 0.05},{"code":"V", "bits": 0.07},{"code":"G", "bits": 0.08},{"code":"N", "bits": 0.10},{"code":"A", "bits": 0.14},{"code":"T", "bits": 0.19},{"code":"S", "bits": 0.47}],
+ [{"code":"S", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"Y", "bits": 0.03},{"code":"V", "bits": 0.06},{"code":"F", "bits": 0.11},{"code":"A", "bits": 0.17},{"code":"M", "bits": 0.23},{"code":"I", "bits": 0.37},{"code":"L", "bits": 0.79}],
+ [{"code":"M", "bits": 0.04},{"code":"L", "bits": 0.12},{"code":"V", "bits": 0.67},{"code":"I", "bits": 2.33}],
+ [{"code":"F", "bits": 0.04},{"code":"Y", "bits": 0.04},{"code":"L", "bits": 0.06},{"code":"W", "bits": 0.41},{"code":"A", "bits": 0.74},{"code":"V", "bits": 0.98}],
+ [{"code":"C", "bits": 0.07},{"code":"A", "bits": 3.75}],
+ [{"code":"K", "bits": 0.01},{"code":"C", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"Y", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"E", "bits": 0.06},{"code":"L", "bits": 0.06},{"code":"R", "bits": 0.06},{"code":"I", "bits": 0.09},{"code":"Q", "bits": 0.12},{"code":"A", "bits": 0.13},{"code":"M", "bits": 0.20},{"code":"V", "bits": 0.24}],
+ [{"code":"C", "bits": 0.04},{"code":"G", "bits": 0.14},{"code":"T", "bits": 0.20},{"code":"S", "bits": 0.26},{"code":"D", "bits": 0.56},{"code":"A", "bits": 0.69}],
+ [{"code":"H", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"L", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"P", "bits": 0.04},{"code":"N", "bits": 0.05},{"code":"D", "bits": 0.06},{"code":"A", "bits": 0.06},{"code":"Q", "bits": 0.06},{"code":"K", "bits": 0.15},{"code":"R", "bits": 0.18},{"code":"E", "bits": 0.21}],
+ [{"code":"T", "bits": 0.04},{"code":"H", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"A", "bits": 0.06},{"code":"Q", "bits": 0.07},{"code":"G", "bits": 0.07},{"code":"S", "bits": 0.07},{"code":"K", "bits": 0.10},{"code":"D", "bits": 0.23},{"code":"N", "bits": 1.41}],
+ [{"code":"D", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"F", "bits": 0.02},{"code":"Y", "bits": 0.03},{"code":"L", "bits": 0.05},{"code":"M", "bits": 0.06},{"code":"H", "bits": 0.07},{"code":"W", "bits": 0.09},{"code":"N", "bits": 0.22},{"code":"R", "bits": 0.43},{"code":"G", "bits": 0.56}],
+ [{"code":"C", "bits": 0.02},{"code":"T", "bits": 0.04},{"code":"E", "bits": 0.06},{"code":"I", "bits": 0.09},{"code":"L", "bits": 0.11},{"code":"A", "bits": 0.31},{"code":"G", "bits": 0.38},{"code":"V", "bits": 0.85}],
+ [{"code":"L", "bits": 0.23},{"code":"I", "bits": 3.61}],
+ [{"code":"A", "bits": 0.05},{"code":"G", "bits": 4.14}],
+ [{"code":"C", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"F", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"D", "bits": 0.04},{"code":"V", "bits": 0.04},{"code":"I", "bits": 0.05},{"code":"Y", "bits": 0.05},{"code":"L", "bits": 0.06},{"code":"N", "bits": 0.06},{"code":"A", "bits": 0.08},{"code":"R", "bits": 0.19},{"code":"K", "bits": 0.32}],
+ [{"code":"S", "bits": 0.02},{"code":"H", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"A", "bits": 0.06},{"code":"Q", "bits": 0.08},{"code":"E", "bits": 0.11},{"code":"K", "bits": 0.13},{"code":"G", "bits": 0.18},{"code":"N", "bits": 0.34},{"code":"D", "bits": 0.60}],
+ [{"code":"S", "bits": 0.03},{"code":"Q", "bits": 0.04},{"code":"D", "bits": 0.04},{"code":"G", "bits": 1.13},{"code":"N", "bits": 1.36}],
+ [{"code":"V", "bits": 0.01},{"code":"N", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"S", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"R", "bits": 0.07},{"code":"A", "bits": 0.08},{"code":"G", "bits": 0.10},{"code":"T", "bits": 0.11},{"code":"Q", "bits": 0.12},{"code":"K", "bits": 0.14},{"code":"D", "bits": 0.17}],
+ [{"code":"I", "bits": 0.37},{"code":"M", "bits": 0.65},{"code":"L", "bits": 1.84}],
+ [{"code":"V", "bits": 0.05},{"code":"I", "bits": 0.14},{"code":"L", "bits": 0.52},{"code":"P", "bits": 2.49}],
+ [{"code":"C", "bits": 0.06},{"code":"Y", "bits": 0.06},{"code":"F", "bits": 0.07},{"code":"V", "bits": 0.11},{"code":"W", "bits": 3.17}],
+ [{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"D", "bits": 0.04},{"code":"P", "bits": 0.05},{"code":"N", "bits": 0.05},{"code":"Y", "bits": 0.08},{"code":"S", "bits": 0.08},{"code":"K", "bits": 0.12},{"code":"R", "bits": 0.42},{"code":"H", "bits": 0.81}],
+ [{"code":"M", "bits": 0.04},{"code":"Y", "bits": 0.05},{"code":"V", "bits": 0.15},{"code":"I", "bits": 0.58},{"code":"L", "bits": 1.76}],
+ [{"code":"A", "bits": 0.04},{"code":"R", "bits": 0.13},{"code":"K", "bits": 0.30},{"code":"S", "bits": 0.32},{"code":"P", "bits": 2.00}],
+ [{"code":"Q", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"T", "bits": 0.05},{"code":"K", "bits": 0.09},{"code":"G", "bits": 0.09},{"code":"S", "bits": 0.10},{"code":"N", "bits": 0.10},{"code":"D", "bits": 0.13},{"code":"A", "bits": 0.32},{"code":"E", "bits": 0.40}],
+ [{"code":"E", "bits": 0.48},{"code":"D", "bits": 3.27}],
+ [{"code":"W", "bits": 0.03},{"code":"Q", "bits": 0.09},{"code":"F", "bits": 0.22},{"code":"M", "bits": 0.60},{"code":"L", "bits": 1.45}],
+ [{"code":"N", "bits": 0.02},{"code":"H", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"E", "bits": 0.04},{"code":"Q", "bits": 0.18},{"code":"R", "bits": 0.22},{"code":"A", "bits": 0.46},{"code":"K", "bits": 0.89}],
+ [{"code":"Q", "bits": 0.02},{"code":"N", "bits": 0.03},{"code":"L", "bits": 0.04},{"code":"W", "bits": 0.06},{"code":"F", "bits": 0.30},{"code":"Y", "bits": 0.31},{"code":"R", "bits": 0.41},{"code":"H", "bits": 0.50}],
+ [{"code":"V", "bits": 0.05},{"code":"Y", "bits": 0.05},{"code":"L", "bits": 0.06},{"code":"F", "bits": 3.80}],
+ [{"code":"T", "bits": 0.03},{"code":"V", "bits": 0.03},{"code":"S", "bits": 0.05},{"code":"Q", "bits": 0.07},{"code":"A", "bits": 0.09},{"code":"R", "bits": 0.50},{"code":"K", "bits": 1.83}],
+ [{"code":"T", "bits": 0.04},{"code":"D", "bits": 0.05},{"code":"N", "bits": 0.05},{"code":"S", "bits": 0.06},{"code":"Q", "bits": 0.14},{"code":"K", "bits": 0.17},{"code":"A", "bits": 0.22},{"code":"R", "bits": 0.22},{"code":"E", "bits": 0.24}],
+ [{"code":"Y", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"A", "bits": 0.02},{"code":"E", "bits": 0.03},{"code":"Q", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"M", "bits": 0.07},{"code":"I", "bits": 0.14},{"code":"V", "bits": 0.20},{"code":"T", "bits": 0.22},{"code":"L", "bits": 0.37}],
+ [{"code":"T", "bits": 4.00}],
+ [{"code":"G", "bits": 0.01},{"code":"E", "bits": 0.02},{"code":"W", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"V", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"A", "bits": 0.03},{"code":"I", "bits": 0.05},{"code":"K", "bits": 0.06},{"code":"S", "bits": 0.11},{"code":"L", "bits": 0.22},{"code":"T", "bits": 0.24},{"code":"M", "bits": 0.26}],
+ [{"code":"E", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"H", "bits": 0.06},{"code":"T", "bits": 0.06},{"code":"S", "bits": 0.07},{"code":"D", "bits": 0.07},{"code":"R", "bits": 0.07},{"code":"N", "bits": 0.19},{"code":"G", "bits": 1.90}],
+ [{"code":"V", "bits": 0.02},{"code":"C", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"G", "bits": 0.05},{"code":"S", "bits": 0.05},{"code":"Q", "bits": 0.06},{"code":"T", "bits": 0.06},{"code":"A", "bits": 0.07},{"code":"N", "bits": 0.07},{"code":"K", "bits": 0.39},{"code":"H", "bits": 0.48}],
+ [{"code":"L", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"S", "bits": 0.03},{"code":"I", "bits": 0.06},{"code":"H", "bits": 0.06},{"code":"V", "bits": 0.15},{"code":"A", "bits": 0.25},{"code":"T", "bits": 0.29},{"code":"P", "bits": 0.71}],
+ [{"code":"C", "bits": 0.03},{"code":"M", "bits": 0.17},{"code":"L", "bits": 0.21},{"code":"I", "bits": 0.79},{"code":"V", "bits": 1.35}],
+ [{"code":"L", "bits": 0.40},{"code":"V", "bits": 0.90},{"code":"I", "bits": 1.50}],
+ [{"code":"V", "bits": 0.06},{"code":"L", "bits": 0.10},{"code":"M", "bits": 3.37}],
+ [{"code":"G", "bits": 4.31}],
+ [{"code":"Y", "bits": 0.04},{"code":"S", "bits": 0.05},{"code":"K", "bits": 0.08},{"code":"R", "bits": 3.45}],
+ [{"code":"H", "bits": 0.03},{"code":"V", "bits": 0.05},{"code":"L", "bits": 0.05},{"code":"A", "bits": 0.06},{"code":"T", "bits": 0.07},{"code":"N", "bits": 0.15},{"code":"R", "bits": 0.36},{"code":"K", "bits": 1.63}],
+ [{"code":"N", "bits": 0.08},{"code":"S", "bits": 0.09},{"code":"T", "bits": 3.63}],
+ [{"code":"A", "bits": 0.03},{"code":"H", "bits": 0.06},{"code":"L", "bits": 0.11},{"code":"Y", "bits": 0.46},{"code":"W", "bits": 0.70},{"code":"F", "bits": 0.88}],
+ [{"code":"K", "bits": 0.03},{"code":"F", "bits": 0.04},{"code":"A", "bits": 0.07},{"code":"L", "bits": 0.08},{"code":"Q", "bits": 0.10},{"code":"D", "bits": 0.50},{"code":"E", "bits": 1.46}],
+ [{"code":"E", "bits": 0.04},{"code":"T", "bits": 0.10},{"code":"G", "bits": 0.12},{"code":"A", "bits": 0.12},{"code":"S", "bits": 2.93}],
+ [{"code":"V", "bits": 0.04},{"code":"M", "bits": 0.14},{"code":"F", "bits": 0.27},{"code":"L", "bits": 0.78},{"code":"I", "bits": 1.10}],
+ [{"code":"L", "bits": 0.03},{"code":"D", "bits": 0.03},{"code":"K", "bits": 0.06},{"code":"N", "bits": 0.07},{"code":"P", "bits": 1.04},{"code":"G", "bits": 1.07}],
+ [{"code":"S", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"Q", "bits": 0.04},{"code":"G", "bits": 0.21},{"code":"K", "bits": 0.61},{"code":"R", "bits": 1.26}],
+ [{"code":"I", "bits": 0.05},{"code":"V", "bits": 0.09},{"code":"L", "bits": 0.14},{"code":"A", "bits": 0.29},{"code":"P", "bits": 2.10}],
+ [{"code":"L", "bits": 3.90}],
+ [{"code":"R", "bits": 0.04},{"code":"D", "bits": 0.04},{"code":"S", "bits": 0.07},{"code":"A", "bits": 0.08},{"code":"K", "bits": 0.28},{"code":"P", "bits": 2.28}],
+ [{"code":"H", "bits": 0.03},{"code":"Q", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"K", "bits": 0.14},{"code":"D", "bits": 0.18},{"code":"N", "bits": 0.59},{"code":"G", "bits": 1.05}],
+ [{"code":"R", "bits": 3.97}],
+ [{"code":"F", "bits": 0.01},{"code":"A", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"P", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"Q", "bits": 0.04},{"code":"V", "bits": 0.05},{"code":"E", "bits": 0.06},{"code":"I", "bits": 0.06},{"code":"K", "bits": 0.07},{"code":"L", "bits": 0.11},{"code":"T", "bits": 0.18},{"code":"R", "bits": 0.19}],
+ [{"code":"S", "bits": 0.13},{"code":"T", "bits": 0.19},{"code":"H", "bits": 0.28},{"code":"N", "bits": 2.21}],
+ [{"code":"F", "bits": 0.04},{"code":"Y", "bits": 0.05},{"code":"L", "bits": 0.23},{"code":"V", "bits": 0.58},{"code":"I", "bits": 1.69}],
+ [{"code":"I", "bits": 0.62},{"code":"V", "bits": 2.91}],
+ [{"code":"M", "bits": 0.06},{"code":"V", "bits": 0.65},{"code":"I", "bits": 0.71},{"code":"L", "bits": 1.09}],
+ [{"code":"S", "bits": 1.25},{"code":"T", "bits": 1.96}],
+ [{"code":"Q", "bits": 0.03},{"code":"G", "bits": 0.04},{"code":"N", "bits": 0.04},{"code":"K", "bits": 0.11},{"code":"T", "bits": 0.12},{"code":"H", "bits": 0.12},{"code":"S", "bits": 0.25},{"code":"R", "bits": 1.75}],
+ [{"code":"A", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"E", "bits": 0.02},{"code":"K", "bits": 0.06},{"code":"R", "bits": 0.08},{"code":"T", "bits": 0.10},{"code":"S", "bits": 0.16},{"code":"Q", "bits": 0.27},{"code":"N", "bits": 0.31},{"code":"D", "bits": 0.38}],
+ [{"code":"I", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"V", "bits": 0.01},{"code":"M", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"G", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"L", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"A", "bits": 0.07},{"code":"K", "bits": 0.07},{"code":"P", "bits": 0.12}],
+ [{"code":"V", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"P", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"K", "bits": 0.04},{"code":"T", "bits": 0.04},{"code":"E", "bits": 0.06},{"code":"A", "bits": 0.06},{"code":"G", "bits": 0.07},{"code":"S", "bits": 0.08},{"code":"N", "bits": 0.08},{"code":"D", "bits": 0.17}],
+ [{"code":"R", "bits": 0.01},{"code":"Q", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"G", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"V", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"D", "bits": 0.03},{"code":"A", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"E", "bits": 0.05},{"code":"L", "bits": 0.08},{"code":"W", "bits": 0.13},{"code":"F", "bits": 0.18},{"code":"Y", "bits": 0.27}],
+ [{"code":"Y", "bits": 0.00},{"code":"G", "bits": 0.01},{"code":"F", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"P", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"V", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"E", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"Q", "bits": 0.05}],
+ [{"code":"W", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"R", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"F", "bits": 0.03},{"code":"I", "bits": 0.03},{"code":"E", "bits": 0.04},{"code":"D", "bits": 0.04},{"code":"L", "bits": 0.04},{"code":"V", "bits": 0.07},{"code":"P", "bits": 0.09},{"code":"A", "bits": 0.25}],
+ [{"code":"Y", "bits": 0.01},{"code":"V", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"N", "bits": 0.04},{"code":"G", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"S", "bits": 0.05},{"code":"A", "bits": 0.07},{"code":"D", "bits": 0.14},{"code":"P", "bits": 0.20},{"code":"E", "bits": 0.25}],
+ [{"code":"H", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"T", "bits": 0.03},{"code":"S", "bits": 0.05},{"code":"K", "bits": 0.05},{"code":"N", "bits": 0.06},{"code":"P", "bits": 0.08},{"code":"A", "bits": 0.09},{"code":"D", "bits": 0.18},{"code":"E", "bits": 0.20},{"code":"G", "bits": 0.92}],
+ [{"code":"K", "bits": 0.01},{"code":"I", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"S", "bits": 0.03},{"code":"E", "bits": 0.04},{"code":"N", "bits": 0.07},{"code":"V", "bits": 0.07},{"code":"D", "bits": 0.08},{"code":"C", "bits": 0.15},{"code":"G", "bits": 0.19},{"code":"A", "bits": 0.32}],
+ [{"code":"M", "bits": 0.01},{"code":"D", "bits": 0.01},{"code":"A", "bits": 0.01},{"code":"S", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"Y", "bits": 0.02},{"code":"K", "bits": 0.03},{"code":"F", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"R", "bits": 0.04},{"code":"L", "bits": 0.09},{"code":"T", "bits": 0.10},{"code":"E", "bits": 0.10},{"code":"V", "bits": 0.10},{"code":"I", "bits": 0.11}],
+ [{"code":"Y", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"M", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"C", "bits": 0.02},{"code":"F", "bits": 0.03},{"code":"W", "bits": 0.04},{"code":"R", "bits": 0.07},{"code":"A", "bits": 0.07},{"code":"L", "bits": 0.12},{"code":"T", "bits": 0.13},{"code":"I", "bits": 0.19},{"code":"V", "bits": 0.84}],
+ [{"code":"M", "bits": 0.02},{"code":"S", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"Y", "bits": 0.05},{"code":"L", "bits": 0.06},{"code":"I", "bits": 0.08},{"code":"C", "bits": 0.09},{"code":"F", "bits": 0.15},{"code":"A", "bits": 0.38},{"code":"V", "bits": 0.57}],
+ [{"code":"E", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"Q", "bits": 0.02},{"code":"K", "bits": 0.04},{"code":"D", "bits": 0.05},{"code":"P", "bits": 0.05},{"code":"R", "bits": 0.06},{"code":"G", "bits": 0.07},{"code":"A", "bits": 0.07},{"code":"T", "bits": 0.08},{"code":"N", "bits": 0.09},{"code":"S", "bits": 0.12},{"code":"H", "bits": 0.28}],
+ [{"code":"G", "bits": 0.08},{"code":"N", "bits": 0.16},{"code":"T", "bits": 0.19},{"code":"D", "bits": 0.33},{"code":"S", "bits": 1.69}],
+ [{"code":"A", "bits": 0.03},{"code":"K", "bits": 0.03},{"code":"M", "bits": 0.05},{"code":"P", "bits": 0.07},{"code":"F", "bits": 0.11},{"code":"V", "bits": 0.30},{"code":"I", "bits": 0.35},{"code":"L", "bits": 0.88}],
+ [{"code":"R", "bits": 0.02},{"code":"G", "bits": 0.03},{"code":"T", "bits": 0.03},{"code":"N", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"S", "bits": 0.06},{"code":"P", "bits": 0.07},{"code":"Q", "bits": 0.09},{"code":"A", "bits": 0.12},{"code":"D", "bits": 0.35},{"code":"E", "bits": 0.55}],
+ [{"code":"R", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"G", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"K", "bits": 0.06},{"code":"S", "bits": 0.11},{"code":"Q", "bits": 0.12},{"code":"A", "bits": 0.24},{"code":"D", "bits": 0.27},{"code":"E", "bits": 0.65}],
+ [{"code":"F", "bits": 0.05},{"code":"G", "bits": 0.07},{"code":"I", "bits": 0.11},{"code":"V", "bits": 0.22},{"code":"L", "bits": 0.24},{"code":"A", "bits": 1.91}],
+ [{"code":"Y", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"K", "bits": 0.04},{"code":"M", "bits": 0.06},{"code":"F", "bits": 0.08},{"code":"V", "bits": 0.15},{"code":"I", "bits": 0.38},{"code":"L", "bits": 1.13}],
+ [{"code":"H", "bits": 0.01},{"code":"V", "bits": 0.01},{"code":"G", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"N", "bits": 0.04},{"code":"T", "bits": 0.04},{"code":"R", "bits": 0.06},{"code":"Q", "bits": 0.06},{"code":"S", "bits": 0.07},{"code":"K", "bits": 0.10},{"code":"D", "bits": 0.10},{"code":"E", "bits": 0.18},{"code":"A", "bits": 0.23}],
+ [{"code":"D", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"W", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"M", "bits": 0.02},{"code":"F", "bits": 0.03},{"code":"V", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"E", "bits": 0.04},{"code":"Y", "bits": 0.04},{"code":"I", "bits": 0.05},{"code":"A", "bits": 0.10},{"code":"L", "bits": 0.22}],
+ [{"code":"T", "bits": 0.04},{"code":"F", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"G", "bits": 0.04},{"code":"Y", "bits": 0.05},{"code":"I", "bits": 0.07},{"code":"V", "bits": 0.11},{"code":"C", "bits": 0.13},{"code":"L", "bits": 0.24},{"code":"A", "bits": 0.64}],
+ [{"code":"H", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"T", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"D", "bits": 0.04},{"code":"S", "bits": 0.05},{"code":"Q", "bits": 0.06},{"code":"G", "bits": 0.07},{"code":"R", "bits": 0.08},{"code":"A", "bits": 0.09},{"code":"E", "bits": 0.09},{"code":"K", "bits": 0.11}],
+ [{"code":"L", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"P", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"N", "bits": 0.05},{"code":"Q", "bits": 0.05},{"code":"S", "bits": 0.05},{"code":"K", "bits": 0.06},{"code":"G", "bits": 0.06},{"code":"A", "bits": 0.07},{"code":"D", "bits": 0.09},{"code":"E", "bits": 0.09}],
+ [{"code":"C", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"R", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"K", "bits": 0.01},{"code":"Q", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"G", "bits": 0.03},{"code":"I", "bits": 0.03},{"code":"S", "bits": 0.04},{"code":"V", "bits": 0.06},{"code":"E", "bits": 0.08},{"code":"D", "bits": 0.08},{"code":"A", "bits": 0.09}],
+ [{"code":"H", "bits": 0.02},{"code":"T", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"N", "bits": 0.04},{"code":"Q", "bits": 0.05},{"code":"A", "bits": 0.05},{"code":"S", "bits": 0.05},{"code":"P", "bits": 0.07},{"code":"K", "bits": 0.08},{"code":"G", "bits": 0.09},{"code":"D", "bits": 0.21},{"code":"E", "bits": 0.33}],
+ [{"code":"V", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"A", "bits": 0.02},{"code":"H", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"P", "bits": 0.03},{"code":"N", "bits": 0.05},{"code":"Q", "bits": 0.07},{"code":"T", "bits": 0.09},{"code":"K", "bits": 0.10},{"code":"R", "bits": 0.12},{"code":"D", "bits": 0.19},{"code":"E", "bits": 0.75}],
+ [{"code":"Y", "bits": 0.02},{"code":"F", "bits": 0.02},{"code":"C", "bits": 0.03},{"code":"P", "bits": 0.03},{"code":"T", "bits": 0.05},{"code":"A", "bits": 0.19},{"code":"L", "bits": 0.23},{"code":"I", "bits": 0.52},{"code":"V", "bits": 0.65}],
+ [{"code":"S", "bits": 0.02},{"code":"I", "bits": 0.04},{"code":"V", "bits": 0.05},{"code":"A", "bits": 0.06},{"code":"C", "bits": 0.07},{"code":"Y", "bits": 0.19},{"code":"M", "bits": 0.26},{"code":"W", "bits": 0.26},{"code":"F", "bits": 0.80}],
+ [{"code":"C", "bits": 0.03},{"code":"L", "bits": 0.10},{"code":"I", "bits": 1.15},{"code":"V", "bits": 1.46}],
+ [{"code":"G", "bits": 0.03},{"code":"F", "bits": 0.05},{"code":"T", "bits": 0.05},{"code":"C", "bits": 0.06},{"code":"L", "bits": 0.07},{"code":"A", "bits": 0.12},{"code":"M", "bits": 0.13},{"code":"V", "bits": 0.16},{"code":"I", "bits": 2.01}],
+ [{"code":"G", "bits": 4.32}],
+ [{"code":"G", "bits": 4.31}],
+ [{"code":"R", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"K", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"S", "bits": 0.16},{"code":"E", "bits": 0.18},{"code":"G", "bits": 0.67},{"code":"A", "bits": 0.93}],
+ [{"code":"H", "bits": 0.02},{"code":"M", "bits": 0.02},{"code":"N", "bits": 0.03},{"code":"D", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"G", "bits": 0.05},{"code":"K", "bits": 0.05},{"code":"T", "bits": 0.06},{"code":"A", "bits": 0.06},{"code":"S", "bits": 0.18},{"code":"Q", "bits": 0.32},{"code":"E", "bits": 0.44}],
+ [{"code":"L", "bits": 0.53},{"code":"V", "bits": 0.63},{"code":"I", "bits": 1.52}],
+ [{"code":"F", "bits": 0.64},{"code":"Y", "bits": 2.68}],
+ [{"code":"H", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"D", "bits": 0.04},{"code":"T", "bits": 0.05},{"code":"N", "bits": 0.05},{"code":"S", "bits": 0.05},{"code":"Q", "bits": 0.08},{"code":"E", "bits": 0.19},{"code":"K", "bits": 0.24},{"code":"R", "bits": 0.25},{"code":"A", "bits": 0.26}],
+ [{"code":"I", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"M", "bits": 0.03},{"code":"T", "bits": 0.03},{"code":"D", "bits": 0.04},{"code":"S", "bits": 0.06},{"code":"A", "bits": 0.22},{"code":"L", "bits": 0.25},{"code":"E", "bits": 0.28},{"code":"Q", "bits": 0.51}],
+ [{"code":"I", "bits": 0.02},{"code":"C", "bits": 0.04},{"code":"V", "bits": 0.04},{"code":"G", "bits": 0.05},{"code":"M", "bits": 0.07},{"code":"S", "bits": 0.08},{"code":"T", "bits": 0.15},{"code":"L", "bits": 0.18},{"code":"F", "bits": 0.30},{"code":"A", "bits": 0.65}],
+ [{"code":"A", "bits": 0.03},{"code":"W", "bits": 0.03},{"code":"E", "bits": 0.03},{"code":"V", "bits": 0.04},{"code":"F", "bits": 0.07},{"code":"I", "bits": 0.27},{"code":"M", "bits": 0.35},{"code":"L", "bits": 1.37}],
+ [{"code":"T", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"K", "bits": 0.05},{"code":"N", "bits": 0.06},{"code":"G", "bits": 0.09},{"code":"S", "bits": 0.09},{"code":"E", "bits": 0.09},{"code":"A", "bits": 0.10},{"code":"D", "bits": 0.24},{"code":"P", "bits": 0.98}],
+ [{"code":"W", "bits": 0.01},{"code":"A", "bits": 0.01},{"code":"S", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"M", "bits": 0.02},{"code":"E", "bits": 0.02},{"code":"K", "bits": 0.03},{"code":"V", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"H", "bits": 0.04},{"code":"I", "bits": 0.04},{"code":"F", "bits": 0.04},{"code":"R", "bits": 0.06},{"code":"Y", "bits": 0.10},{"code":"L", "bits": 0.13}],
+ [{"code":"S", "bits": 0.04},{"code":"I", "bits": 0.06},{"code":"L", "bits": 0.07},{"code":"T", "bits": 0.12},{"code":"C", "bits": 0.26},{"code":"V", "bits": 0.33},{"code":"A", "bits": 1.20}],
+ [{"code":"A", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"R", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"H", "bits": 0.07},{"code":"Q", "bits": 0.09},{"code":"S", "bits": 0.10},{"code":"E", "bits": 0.10},{"code":"N", "bits": 0.12},{"code":"T", "bits": 0.16},{"code":"D", "bits": 0.99}],
+ [{"code":"Y", "bits": 0.02},{"code":"C", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"D", "bits": 0.03},{"code":"I", "bits": 0.03},{"code":"L", "bits": 0.03},{"code":"A", "bits": 0.03},{"code":"H", "bits": 0.04},{"code":"Q", "bits": 0.04},{"code":"V", "bits": 0.07},{"code":"T", "bits": 0.10},{"code":"E", "bits": 0.13},{"code":"K", "bits": 0.22},{"code":"R", "bits": 0.63}],
+ [{"code":"C", "bits": 0.03},{"code":"A", "bits": 0.14},{"code":"M", "bits": 0.16},{"code":"V", "bits": 0.20},{"code":"I", "bits": 0.50},{"code":"L", "bits": 1.11}],
+ [{"code":"C", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"F", "bits": 0.06},{"code":"I", "bits": 0.10},{"code":"H", "bits": 0.11},{"code":"V", "bits": 0.12},{"code":"L", "bits": 0.16},{"code":"E", "bits": 0.21},{"code":"Y", "bits": 0.83}],
+ [{"code":"K", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"M", "bits": 0.05},{"code":"R", "bits": 0.07},{"code":"I", "bits": 0.44},{"code":"V", "bits": 0.46},{"code":"L", "bits": 0.96}],
+ [{"code":"S", "bits": 0.19},{"code":"T", "bits": 3.82}],
+ [{"code":"W", "bits": 0.01},{"code":"T", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"Y", "bits": 0.03},{"code":"F", "bits": 0.03},{"code":"I", "bits": 0.04},{"code":"Q", "bits": 0.04},{"code":"V", "bits": 0.06},{"code":"L", "bits": 0.08},{"code":"H", "bits": 0.09},{"code":"K", "bits": 0.10},{"code":"R", "bits": 0.20},{"code":"E", "bits": 0.33}],
+ [{"code":"L", "bits": 0.13},{"code":"V", "bits": 1.30},{"code":"I", "bits": 1.50}],
+ [{"code":"M", "bits": 0.01},{"code":"S", "bits": 0.01},{"code":"Y", "bits": 0.02},{"code":"G", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"L", "bits": 0.04},{"code":"Q", "bits": 0.05},{"code":"N", "bits": 0.05},{"code":"A", "bits": 0.05},{"code":"K", "bits": 0.06},{"code":"E", "bits": 0.13},{"code":"H", "bits": 0.29},{"code":"D", "bits": 0.40}],
+ [{"code":"M", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"V", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"D", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"E", "bits": 0.05},{"code":"K", "bits": 0.05},{"code":"H", "bits": 0.05},{"code":"T", "bits": 0.05},{"code":"L", "bits": 0.06},{"code":"G", "bits": 0.06},{"code":"A", "bits": 0.17}],
+ [{"code":"I", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"R", "bits": 0.04},{"code":"Q", "bits": 0.04},{"code":"N", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"V", "bits": 0.04},{"code":"A", "bits": 0.08},{"code":"S", "bits": 0.09},{"code":"T", "bits": 0.10},{"code":"D", "bits": 0.19},{"code":"E", "bits": 0.21}],
+ [{"code":"H", "bits": 0.01},{"code":"T", "bits": 0.02},{"code":"A", "bits": 0.05},{"code":"L", "bits": 0.06},{"code":"I", "bits": 0.14},{"code":"P", "bits": 0.15},{"code":"Y", "bits": 0.18},{"code":"V", "bits": 0.27},{"code":"F", "bits": 0.49}],
+ [{"code":"R", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"V", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"N", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"G", "bits": 0.06},{"code":"Q", "bits": 0.07},{"code":"P", "bits": 0.08},{"code":"A", "bits": 0.10},{"code":"D", "bits": 0.33},{"code":"E", "bits": 0.51}],
+ [{"code":"C", "bits": 0.28},{"code":"A", "bits": 0.62},{"code":"G", "bits": 1.54}],
+ [{"code":"E", "bits": 0.05},{"code":"N", "bits": 0.06},{"code":"D", "bits": 3.54}],
+ [{"code":"R", "bits": 0.04},{"code":"I", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"V", "bits": 0.42},{"code":"A", "bits": 0.59},{"code":"T", "bits": 1.24}],
+ [{"code":"Q", "bits": 0.02},{"code":"S", "bits": 0.03},{"code":"K", "bits": 0.04},{"code":"L", "bits": 0.04},{"code":"T", "bits": 0.05},{"code":"V", "bits": 0.06},{"code":"W", "bits": 0.07},{"code":"R", "bits": 0.09},{"code":"H", "bits": 0.10},{"code":"Y", "bits": 0.37},{"code":"F", "bits": 0.79}],
+ [{"code":"V", "bits": 0.04},{"code":"Y", "bits": 0.05},{"code":"I", "bits": 0.05},{"code":"L", "bits": 0.14},{"code":"M", "bits": 0.19},{"code":"A", "bits": 0.29},{"code":"F", "bits": 2.04}],
+ [{"code":"K", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"E", "bits": 0.04},{"code":"D", "bits": 0.07},{"code":"P", "bits": 3.03}],
+ [{"code":"G", "bits": 0.01},{"code":"R", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"V", "bits": 0.04},{"code":"S", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"N", "bits": 0.06},{"code":"P", "bits": 0.08},{"code":"A", "bits": 0.12},{"code":"D", "bits": 0.15},{"code":"E", "bits": 0.28}],
+ [{"code":"M", "bits": 0.02},{"code":"P", "bits": 0.03},{"code":"W", "bits": 0.09},{"code":"V", "bits": 0.11},{"code":"Y", "bits": 0.15},{"code":"F", "bits": 0.32},{"code":"L", "bits": 0.35},{"code":"I", "bits": 0.45}],
+ [{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"L", "bits": 0.03},{"code":"R", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"A", "bits": 0.04},{"code":"E", "bits": 0.09},{"code":"G", "bits": 0.09},{"code":"S", "bits": 0.10},{"code":"P", "bits": 0.11},{"code":"N", "bits": 0.15},{"code":"D", "bits": 0.72}],
+ [{"code":"H", "bits": 0.01},{"code":"M", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"F", "bits": 0.01},{"code":"T", "bits": 0.01},{"code":"G", "bits": 0.01},{"code":"Q", "bits": 0.01},{"code":"Y", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"W", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"D", "bits": 0.03},{"code":"K", "bits": 0.03},{"code":"L", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"E", "bits": 0.06},{"code":"P", "bits": 0.07}],
+ [{"code":"M", "bits": 0.01},{"code":"V", "bits": 0.01},{"code":"F", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"R", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"K", "bits": 0.04},{"code":"G", "bits": 0.04},{"code":"T", "bits": 0.05},{"code":"N", "bits": 0.06},{"code":"A", "bits": 0.08},{"code":"E", "bits": 0.10},{"code":"D", "bits": 0.11},{"code":"S", "bits": 0.11}],
+ [{"code":"W", "bits": 0.01},{"code":"P", "bits": 0.01},{"code":"H", "bits": 0.01},{"code":"T", "bits": 0.02},{"code":"F", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"G", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"V", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"Q", "bits": 0.06},{"code":"D", "bits": 0.06},{"code":"E", "bits": 0.13}],
+ [{"code":"T", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"D", "bits": 0.03},{"code":"V", "bits": 0.04},{"code":"H", "bits": 0.05},{"code":"Y", "bits": 0.08},{"code":"F", "bits": 0.46},{"code":"W", "bits": 1.53}],
+ [{"code":"G", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"D", "bits": 0.02},{"code":"W", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"A", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"V", "bits": 0.04},{"code":"T", "bits": 0.06},{"code":"Q", "bits": 0.09},{"code":"E", "bits": 0.11},{"code":"R", "bits": 0.12},{"code":"K", "bits": 0.12}],
+ [{"code":"D", "bits": 0.01},{"code":"M", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"C", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"Q", "bits": 0.04},{"code":"T", "bits": 0.04},{"code":"R", "bits": 0.04},{"code":"I", "bits": 0.06},{"code":"K", "bits": 0.09},{"code":"V", "bits": 0.11},{"code":"L", "bits": 0.28},{"code":"E", "bits": 0.42}],
+ [{"code":"W", "bits": 0.01},{"code":"F", "bits": 0.01},{"code":"M", "bits": 0.01},{"code":"R", "bits": 0.01},{"code":"Q", "bits": 0.02},{"code":"D", "bits": 0.02},{"code":"K", "bits": 0.03},{"code":"S", "bits": 0.04},{"code":"E", "bits": 0.06},{"code":"A", "bits": 0.07},{"code":"L", "bits": 0.10},{"code":"I", "bits": 0.17},{"code":"T", "bits": 0.20},{"code":"V", "bits": 0.38}],
+ [{"code":"W", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"V", "bits": 0.01},{"code":"P", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"Y", "bits": 0.02},{"code":"N", "bits": 0.02},{"code":"F", "bits": 0.02},{"code":"G", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"D", "bits": 0.05},{"code":"A", "bits": 0.11},{"code":"E", "bits": 0.14},{"code":"S", "bits": 0.23}],
+ [{"code":"L", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"V", "bits": 0.03},{"code":"N", "bits": 0.03},{"code":"D", "bits": 0.04},{"code":"T", "bits": 0.04},{"code":"A", "bits": 0.05},{"code":"Q", "bits": 0.06},{"code":"K", "bits": 0.09},{"code":"S", "bits": 0.16},{"code":"E", "bits": 0.20},{"code":"R", "bits": 0.45}],
+ [{"code":"I", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"Y", "bits": 0.01},{"code":"V", "bits": 0.01},{"code":"G", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"F", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"A", "bits": 0.02},{"code":"R", "bits": 0.03},{"code":"K", "bits": 0.03},{"code":"D", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"P", "bits": 0.04},{"code":"E", "bits": 0.07}],
+ [{"code":"W", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"T", "bits": 0.01},{"code":"A", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"V", "bits": 0.02},{"code":"Y", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"D", "bits": 0.03},{"code":"F", "bits": 0.03},{"code":"S", "bits": 0.06},{"code":"E", "bits": 0.07},{"code":"G", "bits": 0.10},{"code":"H", "bits": 0.13}],
+ [{"code":"Y", "bits": 0.00},{"code":"F", "bits": 0.01},{"code":"N", "bits": 0.01},{"code":"R", "bits": 0.01},{"code":"L", "bits": 0.01},{"code":"T", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"V", "bits": 0.02},{"code":"K", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"A", "bits": 0.03},{"code":"W", "bits": 0.03},{"code":"D", "bits": 0.03},{"code":"G", "bits": 0.03},{"code":"P", "bits": 0.07},{"code":"E", "bits": 0.07}],
+ [{"code":"N", "bits": 0.01},{"code":"M", "bits": 0.01},{"code":"D", "bits": 0.01},{"code":"G", "bits": 0.01},{"code":"L", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"I", "bits": 0.03},{"code":"T", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"P", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"V", "bits": 0.05},{"code":"K", "bits": 0.07},{"code":"A", "bits": 0.12}],
+ [{"code":"F", "bits": 0.01},{"code":"L", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"R", "bits": 0.02},{"code":"H", "bits": 0.03},{"code":"K", "bits": 0.03},{"code":"N", "bits": 0.04},{"code":"V", "bits": 0.04},{"code":"E", "bits": 0.05},{"code":"S", "bits": 0.05},{"code":"A", "bits": 0.05},{"code":"T", "bits": 0.06},{"code":"G", "bits": 0.07},{"code":"Q", "bits": 0.10},{"code":"D", "bits": 0.43}],
+ [{"code":"V", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"N", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"K", "bits": 0.03},{"code":"G", "bits": 0.04},{"code":"P", "bits": 0.04},{"code":"T", "bits": 0.09},{"code":"A", "bits": 0.10},{"code":"D", "bits": 0.12},{"code":"S", "bits": 0.16},{"code":"E", "bits": 0.53}],
+ [{"code":"H", "bits": 0.02},{"code":"P", "bits": 0.02},{"code":"T", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"Y", "bits": 0.03},{"code":"N", "bits": 0.03},{"code":"G", "bits": 0.04},{"code":"S", "bits": 0.05},{"code":"A", "bits": 0.05},{"code":"D", "bits": 0.09},{"code":"R", "bits": 0.10},{"code":"E", "bits": 0.19},{"code":"K", "bits": 0.27}],
+ [{"code":"Q", "bits": 0.02},{"code":"F", "bits": 0.03},{"code":"A", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"T", "bits": 0.06},{"code":"E", "bits": 0.06},{"code":"S", "bits": 0.07},{"code":"G", "bits": 0.10},{"code":"H", "bits": 0.14},{"code":"D", "bits": 0.15},{"code":"N", "bits": 0.56}],
+ [{"code":"V", "bits": 0.01},{"code":"I", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"L", "bits": 0.02},{"code":"T", "bits": 0.02},{"code":"Q", "bits": 0.03},{"code":"R", "bits": 0.03},{"code":"N", "bits": 0.03},{"code":"S", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"E", "bits": 0.05},{"code":"A", "bits": 0.08},{"code":"D", "bits": 0.09},{"code":"P", "bits": 0.11},{"code":"G", "bits": 0.22}],
+ [{"code":"D", "bits": 0.01},{"code":"E", "bits": 0.01},{"code":"A", "bits": 0.04},{"code":"T", "bits": 0.04},{"code":"P", "bits": 0.06},{"code":"H", "bits": 0.07},{"code":"V", "bits": 0.08},{"code":"F", "bits": 0.10},{"code":"I", "bits": 0.12},{"code":"L", "bits": 0.17},{"code":"Y", "bits": 0.35}],
+ [{"code":"H", "bits": 0.01},{"code":"Q", "bits": 0.03},{"code":"T", "bits": 0.03},{"code":"N", "bits": 0.04},{"code":"G", "bits": 0.04},{"code":"K", "bits": 0.05},{"code":"S", "bits": 0.06},{"code":"E", "bits": 0.06},{"code":"R", "bits": 0.10},{"code":"P", "bits": 0.12},{"code":"A", "bits": 0.14},{"code":"D", "bits": 0.14}],
+ [{"code":"W", "bits": 0.02},{"code":"I", "bits": 0.02},{"code":"V", "bits": 0.03},{"code":"C", "bits": 0.03},{"code":"T", "bits": 0.04},{"code":"M", "bits": 0.05},{"code":"L", "bits": 0.08},{"code":"H", "bits": 0.15},{"code":"F", "bits": 0.67},{"code":"Y", "bits": 1.13}],
+ [{"code":"N", "bits": 0.01},{"code":"C", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"V", "bits": 0.03},{"code":"Y", "bits": 0.03},{"code":"Q", "bits": 0.03},{"code":"K", "bits": 0.05},{"code":"A", "bits": 0.07},{"code":"D", "bits": 0.08},{"code":"E", "bits": 0.11},{"code":"S", "bits": 0.16},{"code":"T", "bits": 0.18},{"code":"R", "bits": 0.19}],
+ [{"code":"M", "bits": 0.03},{"code":"L", "bits": 0.04},{"code":"W", "bits": 0.04},{"code":"V", "bits": 0.10},{"code":"I", "bits": 0.13},{"code":"Y", "bits": 0.33},{"code":"F", "bits": 2.07}],
+ [{"code":"M", "bits": 0.01},{"code":"H", "bits": 0.02},{"code":"S", "bits": 0.02},{"code":"Y", "bits": 0.02},{"code":"A", "bits": 0.03},{"code":"C", "bits": 0.03},{"code":"K", "bits": 0.04},{"code":"T", "bits": 0.05},{"code":"R", "bits": 0.05},{"code":"I", "bits": 0.07},{"code":"Q", "bits": 0.07},{"code":"E", "bits": 0.11},{"code":"L", "bits": 0.13},{"code":"V", "bits": 0.28}],
+ [{"code":"N", "bits": 0.02},{"code":"Q", "bits": 0.02},{"code":"S", "bits": 0.03},{"code":"H", "bits": 0.03},{"code":"M", "bits": 0.04},{"code":"K", "bits": 0.04},{"code":"L", "bits": 0.05},{"code":"D", "bits": 0.05},{"code":"E", "bits": 0.06},{"code":"R", "bits": 0.07},{"code":"I", "bits": 0.12},{"code":"V", "bits": 0.20},{"code":"T", "bits": 0.31}],
+ [{"code":"F", "bits": 0.20},{"code":"W", "bits": 0.31},{"code":"L", "bits": 0.53},{"code":"Y", "bits": 1.63}],
+ [{"code":"N", "bits": 0.02},{"code":"H", "bits": 0.02},{"code":"L", "bits": 0.03},{"code":"S", "bits": 0.03},{"code":"A", "bits": 0.03},{"code":"I", "bits": 0.04},{"code":"T", "bits": 0.07},{"code":"D", "bits": 0.08},{"code":"K", "bits": 0.09},{"code":"Q", "bits": 0.10},{"code":"V", "bits": 0.12},{"code":"R", "bits": 0.13},{"code":"E", "bits": 0.46}],
+ [{"code":"K", "bits": 0.68},{"code":"R", "bits": 2.78}]
+ ],
+ "couplings": [
+ {"i": 1,"j": 91, "score": 0.37, "iC": "IL", "jC": "SAVILC", "matrix": [[-0.16, -0.14, 0.01, 0.16, 0.33, 0.01],[0.16, 0.34, -0.27, -0.34, -0.17, -0.15]]},
+ {"i": 1,"j": 107, "score": 0.44, "iC": "ILF", "jC": "AVC", "matrix": [[0.51, -0.19, -0.27],[-0.13, 0.15, -0.18],[-0.22, 0.00, 0.33]]},
+ {"i": 2,"j": 90, "score": 1.10, "iC": "EKNSTAVIC", "jC": "DEKRHTVL", "matrix": [[-0.09, -0.20, 0.08, 0.37, 0.00, 0.00, -0.02, 0.01],[0.37, 0.21, -0.23, -0.17, -0.01, -0.01, 0.01, -0.02],[0.21, 0.13, -0.15, -0.23, -0.01, 0.00, -0.01, -0.06],[-0.37, 0.93, -0.06, -0.12, 0.26, -0.23, -0.05, -0.08],[-0.09, 0.49, -0.22, 0.03, 0.04, -0.22, -0.06, -0.17],[-0.12, -0.34, -0.04, 0.04, -0.11, 0.35, 0.02, 0.24],[-0.25, -0.08, -0.06, 0.06, -0.08, 0.21, 0.16, 0.03],[0.16, -0.38, 0.44, -0.05, 0.02, -0.03, 0.00, -0.02],[0.01, -0.20, 0.09, 0.14, -0.02, -0.01, -0.02, 0.04]]},
+ {"i": 2,"j": 92, "score": 0.71, "iC": "KRHQNSTGAVIF", "jC": "AMFWY", "matrix": [[0.02, -0.08, -0.09, 0.27, 0.03],[-0.04, -0.00, -0.28, 0.21, -0.06],[-0.03, -0.03, 0.03, 0.15, 0.02],[-0.02, 0.03, 0.23, -0.10, -0.14],[-0.08, -0.18, -0.02, 0.37, 0.08],[-0.09, 0.24, 0.20, -0.33, -0.09],[-0.06, 0.11, 0.16, -0.44, -0.20],[-0.04, -0.01, -0.31, 0.55, 0.02],[-0.13, 0.20, 0.04, -0.05, -0.09],[0.07, -0.05, -0.12, -0.23, 0.05],[0.05, -0.10, 0.05, -0.17, 0.36],[0.16, -0.05, -0.04, -0.01, -0.02]]},
+ {"i": 2,"j": 109, "score": 0.82, "iC": "EKRHQNSTGAV", "jC": "EKRQTAVILCY", "matrix": [[-0.12, -0.02, -0.00, -0.04, 0.08, 0.02, 0.16, 0.08, -0.03, -0.03, 0.00],[0.61, -0.28, -0.40, 0.18, 0.07, 0.07, -0.13, -0.08, -0.02, -0.04, -0.07],[0.46, -0.05, -0.27, -0.06, -0.09, -0.02, -0.05, -0.03, 0.05, -0.03, -0.01],[-0.12, -0.00, -0.28, 0.05, 0.10, -0.03, 0.10, 0.05, -0.03, 0.01, -0.02],[0.02, -0.00, -0.12, -0.04, 0.05, 0.15, 0.05, -0.01, -0.01, -0.01, -0.02],[-0.34, 0.14, 0.32, -0.03, -0.02, -0.03, 0.04, 0.01, -0.04, -0.02, 0.01],[0.15, 0.09, 0.26, -0.00, -0.15, -0.09, -0.18, 0.00, -0.09, 0.10, 0.00],[-0.25, 0.15, 0.26, -0.02, -0.08, 0.18, -0.18, -0.17, -0.06, 0.23, -0.04],[-0.15, -0.04, -0.12, -0.07, 0.06, -0.08, 0.30, 0.04, 0.18, -0.04, -0.03],[0.02, -0.21, -0.01, -0.02, 0.17, -0.18, 0.07, 0.09, 0.09, -0.08, 0.23],[0.02, 0.00, 0.24, -0.01, -0.13, 0.01, -0.02, -0.01, -0.01, -0.01, -0.00]]},
+ {"i": 2,"j": 111, "score": 1.37, "iC": "EKHQNSTAVIC", "jC": "DERHVILFY", "matrix": [[-0.01, -0.07, 0.06, 0.32, 0.00, -0.07, -0.11, -0.06, -0.07],[-0.03, 0.01, -0.05, -0.07, 0.02, 0.29, -0.08, -0.06, 0.04],[0.05, -0.07, 0.01, 0.16, 0.08, -0.08, -0.08, -0.03, -0.00],[-0.01, -0.05, 0.03, 0.24, -0.06, 0.02, -0.04, -0.04, -0.09],[-0.03, -0.22, -0.05, 0.08, -0.05, -0.19, 0.01, 0.13, 0.41],[-0.14, -0.40, -0.14, 0.16, 0.04, -0.10, -0.12, 0.07, 0.74],[0.15, 0.17, 0.24, -0.29, 0.15, 0.18, 0.45, -0.28, -1.07],[-0.05, -0.14, -0.08, 0.03, -0.08, -0.15, -0.13, 0.21, 0.64],[0.01, 0.38, 0.04, -0.10, 0.04, 0.08, -0.03, -0.09, -0.42],[0.05, 0.30, 0.07, -0.18, -0.06, 0.13, 0.07, -0.08, -0.26],[0.02, -0.04, -0.01, -0.01, -0.06, -0.03, -0.05, 0.05, 0.20]]},
+ {"i": 3,"j": 4, "score": 0.44, "iC": "GAIMF", "jC": "VI", "matrix": [[-0.12, 0.16],[-0.16, 0.21],[0.14, -0.20],[-0.19, 0.34],[0.32, -0.43]]},
+ {"i": 3,"j": 100, "score": 0.50, "iC": "SILMFY", "jC": "IFY", "matrix": [[-0.01, -0.13, 0.16],[0.17, -0.24, -0.08],[-0.09, -0.00, 0.19],[-0.04, -0.20, 0.37],[-0.05, 0.42, -0.34],[-0.01, 0.20, -0.18]]},
+ {"i": 3,"j": 103, "score": 0.75, "iC": "HSGAVILMFY", "jC": "STGAVILMCF", "matrix": [[0.08, 0.34, -0.03, -0.18, -0.01, -0.01, -0.03, -0.03, -0.02, -0.08],[0.03, 0.16, -0.02, -0.03, -0.04, 0.02, -0.01, -0.05, -0.02, 0.02],[0.01, -0.06, -0.03, -0.12, -0.00, 0.00, -0.00, 0.01, -0.01, 0.22],[-0.05, 0.03, -0.11, 0.08, -0.07, -0.06, 0.21, 0.17, -0.08, -0.08],[0.04, -0.01, -0.05, 0.18, -0.01, 0.04, -0.13, 0.04, 0.03, -0.12],[0.11, -0.08, 0.06, 0.30, 0.15, -0.02, -0.20, -0.18, 0.04, -0.05],[0.15, 0.14, -0.13, 0.17, 0.19, 0.19, -0.37, -0.16, -0.20, -0.13],[-0.23, -0.58, 0.38, -0.18, -0.05, -0.03, 0.07, 0.11, 0.31, 0.11],[-0.12, -0.03, -0.03, -0.17, -0.15, -0.11, 0.36, 0.13, -0.06, 0.15],[-0.03, -0.07, -0.01, -0.13, -0.04, -0.02, 0.25, -0.01, -0.01, 0.07]]},
+ {"i": 3,"j": 104, "score": 0.42, "iC": "SAVILMFY", "jC": "VILMFW", "matrix": [[0.01, -0.02, -0.29, 0.24, -0.05, -0.02],[-0.02, -0.12, -0.05, 0.02, 0.03, 0.20],[0.19, 0.09, -0.04, -0.13, -0.01, -0.03],[-0.02, 0.20, 0.28, -0.18, -0.02, -0.10],[-0.07, 0.32, 0.33, -0.03, -0.06, -0.12],[-0.04, -0.18, -0.00, 0.06, 0.10, -0.00],[0.01, -0.05, -0.22, -0.10, 0.17, 0.03],[-0.03, -0.10, -0.18, 0.13, -0.01, 0.01]]},
+ {"i": 3,"j": 107, "score": 1.48, "iC": "SGAILMFY", "jC": "STAVILC", "matrix": [[0.02, -0.01, -0.28, 0.16, 0.15, -0.01, -0.02],[-0.02, -0.01, -0.24, -0.13, 0.15, 0.37, -0.10],[-0.16, 0.20, -1.18, -0.26, 0.37, 0.43, 0.37],[0.11, 0.19, 0.23, 0.09, -0.30, -0.10, 0.04],[-0.15, -0.32, 0.92, -0.02, -0.12, -0.30, -0.08],[0.13, 0.12, 0.41, -0.23, 0.00, -0.22, -0.07],[-0.05, -0.20, 0.29, 0.25, -0.13, -0.08, -0.11],[-0.02, -0.02, -0.11, 0.30, -0.04, -0.02, -0.07]]},
+ {"i": 3,"j": 125, "score": 0.54, "iC": "HSAILMF", "jC": "MFY", "matrix": [[-0.03, -0.40, 0.52],[0.00, -0.17, 0.13],[-0.23, 0.22, -0.11],[0.01, 0.34, -0.17],[-0.03, 0.21, -0.22],[-0.17, -0.06, -0.07],[0.28, -0.11, -0.08]]},
+ {"i": 4,"j": 3, "score": 0.44, "iC": "VI", "jC": "GAIMF", "matrix": [[-0.12, -0.16, 0.14, -0.19, 0.32],[0.16, 0.21, -0.20, 0.34, -0.43]]},
+ {"i": 4,"j": 33, "score": 0.63, "iC": "VILM", "jC": "STVILM", "matrix": [[-0.08, -0.20, 0.42, 0.47, 0.25, -0.36],[0.15, 0.14, -0.22, -0.17, -0.25, 0.08],[-0.02, -0.08, -0.14, -0.25, 0.26, 0.04],[-0.01, 0.20, -0.01, -0.04, -0.11, 0.04]]},
+ {"i": 4,"j": 92, "score": 0.95, "iC": "VIL", "jC": "HSVMCFW", "matrix": [[0.21, 0.24, -0.08, 0.15, 0.38, -0.52, -0.54],[-0.18, -0.27, -0.11, 0.23, -0.42, 0.38, 0.61],[-0.02, 0.01, 0.16, -0.25, -0.05, 0.24, -0.03]]},
+ {"i": 5,"j": 7, "score": 1.11, "iC": "AVLWY", "jC": "EKRHQTAVILY", "matrix": [[-0.16, -0.04, -0.21, -0.07, -0.30, -0.22, -0.15, 0.49, 0.21, 0.66, -0.13],[-0.34, 0.15, 0.01, 0.19, -0.36, 0.28, 0.19, 0.01, 0.03, -0.40, 0.26],[-0.05, -0.02, 0.10, -0.03, -0.06, 0.05, 0.21, -0.15, -0.07, -0.08, -0.03],[0.61, -0.04, -0.19, -0.05, 0.78, -0.10, -0.15, -0.36, -0.20, -0.12, -0.08],[-0.01, -0.01, 0.24, -0.02, 0.02, 0.03, -0.06, -0.06, -0.04, -0.03, -0.02]]},
+ {"i": 5,"j": 13, "score": 0.60, "iC": "AV", "jC": "IL", "matrix": [[-0.24, 0.45],[0.38, -0.53]]},
+ {"i": 5,"j": 110, "score": 0.56, "iC": "AVLFWY", "jC": "VILM", "matrix": [[-0.26, -0.28, 0.25, 0.20],[0.02, 0.18, -0.13, 0.02],[0.13, 0.20, -0.31, -0.07],[0.06, 0.00, -0.26, 0.16],[-0.07, -0.11, 0.50, -0.28],[0.23, 0.06, -0.23, -0.05]]},
+ {"i": 5,"j": 112, "score": 1.06, "iC": "SAVFWY", "jC": "RAVIL", "matrix": [[-0.01, -0.01, -0.11, 0.02, 0.19],[-0.11, -0.18, -0.70, 0.33, 0.80],[-0.12, 0.28, 0.37, 0.08, -0.37],[0.03, -0.00, 0.16, 0.00, -0.32],[0.18, -0.05, 0.27, -0.23, -0.44],[0.13, 0.01, 0.16, -0.19, -0.25]]},
+ {"i": 5,"j": 125, "score": 0.66, "iC": "AVLFWY", "jC": "AVLMF", "matrix": [[-0.23, -0.10, 0.00, -0.13, 0.41],[-0.33, -0.20, 0.21, -0.07, 0.37],[-0.03, 0.23, 0.01, -0.10, -0.09],[0.12, 0.04, -0.01, -0.01, -0.19],[0.37, -0.01, -0.16, 0.13, -0.35],[0.08, 0.07, -0.08, 0.20, -0.30]]},
+ {"i": 7,"j": 5, "score": 1.11, "iC": "EKRHQTAVILY", "jC": "AVLWY", "matrix": [[-0.16, -0.34, -0.05, 0.61, -0.01],[-0.04, 0.15, -0.02, -0.04, -0.01],[-0.21, 0.01, 0.10, -0.19, 0.24],[-0.07, 0.19, -0.03, -0.05, -0.02],[-0.30, -0.36, -0.06, 0.78, 0.02],[-0.22, 0.28, 0.05, -0.10, 0.03],[-0.15, 0.19, 0.21, -0.15, -0.06],[0.49, 0.01, -0.15, -0.36, -0.06],[0.21, 0.03, -0.07, -0.20, -0.04],[0.66, -0.40, -0.08, -0.12, -0.03],[-0.13, 0.26, -0.03, -0.08, -0.02]]},
+ {"i": 7,"j": 8, "score": 0.40, "iC": "EHQTAVLM", "jC": "DSTA", "matrix": [[0.11, -0.09, -0.15, 0.16],[0.21, -0.07, 0.01, -0.09],[-0.03, 0.09, 0.26, -0.16],[0.18, -0.11, -0.04, -0.02],[-0.15, -0.10, 0.27, -0.03],[-0.23, 0.31, -0.37, 0.30],[-0.10, -0.05, 0.09, -0.31],[0.19, -0.13, 0.17, -0.16]]},
+ {"i": 7,"j": 11, "score": 1.40, "iC": "EKRHQAVILMY", "jC": "DRHQNGLWY", "matrix": [[-0.03, 0.01, 0.45, 0.02, -0.17, -0.12, -0.05, -0.04, -0.04],[0.06, -0.29, 0.04, -0.02, 0.43, -0.08, -0.03, -0.02, -0.03],[-0.04, -0.46, 0.02, -0.04, 0.02, 0.56, -0.06, -0.05, 0.04],[-0.02, 0.22, -0.01, -0.06, -0.14, -0.22, 0.14, -0.01, 0.01],[-0.01, 0.16, -0.21, -0.05, -0.10, 0.32, -0.06, -0.06, -0.06],[0.27, -0.55, -0.11, -0.02, 0.25, -0.07, 0.05, 0.18, -0.06],[-0.00, -0.57, -0.32, -0.03, 0.10, 0.35, 0.15, 0.22, -0.06],[-0.05, -0.07, -0.06, -0.03, 0.14, 0.19, -0.03, -0.09, 0.06],[-0.07, 0.12, 0.28, -0.03, -0.06, -0.38, -0.04, -0.06, 0.17],[-0.06, 1.00, -0.01, 0.19, -0.27, -0.41, -0.16, -0.01, -0.11],[-0.02, 0.35, 0.04, 0.04, -0.21, -0.21, -0.02, -0.01, 0.01]]},
+ {"i": 7,"j": 110, "score": 0.60, "iC": "ERQTAVILM", "jC": "AVILM", "matrix": [[-0.05, 0.01, -0.01, 0.26, -0.10],[0.05, 0.14, -0.05, -0.25, -0.00],[0.05, -0.10, 0.06, 0.17, -0.18],[-0.01, 0.11, 0.19, -0.04, -0.16],[0.01, 0.33, 0.30, -0.41, -0.18],[0.19, -0.21, -0.06, 0.07, -0.16],[-0.10, -0.13, -0.16, 0.17, 0.26],[-0.07, -0.09, -0.41, 0.28, 0.27],[-0.11, -0.19, 0.14, 0.09, 0.16]]},
+ {"i": 7,"j": 112, "score": 0.83, "iC": "ERHQTAVILMY", "jC": "EKRAVILMF", "matrix": [[-0.02, 0.19, 0.32, -0.03, -0.01, -0.17, -0.24, -0.03, -0.03],[0.17, -0.03, -0.05, -0.04, 0.05, 0.07, -0.10, 0.01, -0.03],[-0.01, -0.01, -0.03, -0.01, 0.13, 0.30, -0.35, -0.04, -0.02],[-0.08, -0.03, 0.12, -0.07, 0.25, -0.06, -0.23, 0.04, -0.03],[0.02, 0.02, 0.06, -0.02, -0.24, -0.06, -0.06, -0.04, 0.02],[-0.03, -0.00, -0.08, -0.14, -0.38, -0.21, 0.53, 0.10, 0.17],[-0.01, -0.01, -0.05, -0.17, -0.13, 0.11, 0.11, 0.16, 0.09],[-0.02, -0.03, -0.07, -0.04, 0.11, 0.15, 0.11, -0.06, -0.08],[0.02, -0.02, -0.03, 0.05, -0.06, -0.24, 0.37, -0.02, 0.00],[-0.01, -0.10, -0.18, -0.07, 0.30, 0.14, 0.13, 0.00, -0.08],[-0.01, -0.02, -0.03, 0.49, -0.03, -0.03, -0.29, -0.05, -0.02]]},
+ {"i": 7,"j": 114, "score": 0.86, "iC": "EKRHQAVILMY", "jC": "DEKRHQVILFW", "matrix": [[-0.10, -0.10, 0.29, 0.10, -0.12, -0.05, 0.15, 0.04, -0.07, -0.08, -0.04],[0.02, 0.30, -0.12, -0.17, -0.09, 0.04, 0.03, 0.00, -0.04, 0.01, -0.01],[0.17, 0.51, -0.05, -0.30, -0.15, 0.01, 0.04, 0.04, -0.09, -0.05, -0.03],[-0.02, 0.03, -0.00, -0.09, -0.11, -0.03, 0.07, -0.05, 0.17, -0.02, -0.04],[0.21, -0.12, -0.06, -0.31, -0.07, 0.29, 0.02, 0.04, -0.00, -0.01, -0.02],[0.05, -0.07, 0.04, 0.70, -0.14, -0.08, -0.01, -0.15, -0.24, -0.05, -0.04],[-0.08, 0.07, 0.21, 0.10, 0.18, 0.02, -0.17, -0.26, -0.13, -0.09, -0.01],[-0.07, -0.25, -0.11, -0.08, 0.36, -0.00, -0.04, 0.13, 0.09, 0.09, -0.00],[-0.06, -0.31, -0.01, 0.07, 0.22, -0.06, -0.05, -0.03, 0.03, -0.01, 0.18],[-0.12, -0.42, -0.12, -0.10, 0.04, -0.07, 0.01, 0.21, 0.14, 0.26, 0.09],[-0.02, 0.50, -0.03, -0.13, -0.07, -0.05, -0.06, -0.00, -0.02, -0.00, -0.02]]},
+ {"i": 7,"j": 125, "score": 0.45, "iC": "ERQTAVM", "jC": "AMF", "matrix": [[0.21, 0.18, -0.26],[0.03, 0.07, -0.24],[0.40, 0.03, -0.34],[-0.03, -0.06, 0.20],[-0.05, -0.01, -0.18],[-0.22, -0.08, 0.27],[-0.14, 0.01, 0.24]]},
+ {"i": 7,"j": 128, "score": 0.49, "iC": "ERHQTILMY", "jC": "PILFY", "matrix": [[-0.04, 0.23, 0.05, -0.21, -0.08],[0.26, -0.29, 0.07, 0.35, -0.11],[0.00, -0.17, -0.07, -0.18, 0.56],[0.01, 0.13, 0.17, -0.07, -0.09],[0.08, -0.06, 0.03, -0.16, 0.03],[-0.04, 0.11, -0.10, 0.16, 0.01],[-0.03, -0.11, -0.15, 0.08, 0.16],[-0.10, 0.04, -0.19, 0.39, -0.22],[-0.02, -0.13, 0.15, -0.01, -0.09]]},
+ {"i": 8,"j": 7, "score": 0.40, "iC": "DSTA", "jC": "EHQTAVLM", "matrix": [[0.11, 0.21, -0.03, 0.18, -0.15, -0.23, -0.10, 0.19],[-0.09, -0.07, 0.09, -0.11, -0.10, 0.31, -0.05, -0.13],[-0.15, 0.01, 0.26, -0.04, 0.27, -0.37, 0.09, 0.17],[0.16, -0.09, -0.16, -0.02, -0.03, 0.30, -0.31, -0.16]]},
+ {"i": 8,"j": 9, "score": 0.49, "iC": "DSTAC", "jC": "DRHNTPAL", "matrix": [[-0.09, 0.28, -0.05, -0.06, -0.18, -0.08, -0.04, 0.13],[0.11, -0.10, -0.20, -0.18, 0.17, -0.12, -0.10, 0.15],[-0.10, -0.11, -0.08, -0.10, 0.13, 0.42, -0.08, -0.01],[0.22, -0.10, 0.23, 0.23, -0.19, -0.45, 0.20, -0.30],[0.06, -0.06, -0.01, 0.16, 0.02, 0.05, -0.07, -0.05]]},
+ {"i": 8,"j": 10, "score": 1.06, "iC": "DNSTGA", "jC": "DEKRHQNSTGA", "matrix": [[-0.68, -0.02, 0.38, 0.33, 0.20, 0.18, -0.33, -0.16, -0.09, -0.21, 0.34],[0.06, -0.01, 0.00, -0.02, 0.00, 0.16, -0.25, -0.03, 0.05, -0.03, -0.03],[-0.03, -0.08, -0.18, -0.07, -0.07, -0.12, 0.51, 0.15, 0.07, -0.07, -0.02],[0.12, 0.21, 0.12, -0.05, -0.14, 0.05, -0.46, 0.18, 0.11, -0.20, 0.08],[0.12, -0.01, -0.15, -0.04, 0.03, 0.00, 0.23, -0.05, -0.05, 0.00, -0.06],[0.24, -0.14, -0.12, -0.17, 0.01, -0.18, 0.47, -0.12, -0.16, 0.38, -0.25]]},
+ {"i": 8,"j": 12, "score": 1.44, "iC": "DSTGAC", "jC": "ETGAVIL", "matrix": [[-0.42, -0.03, 0.59, -0.01, -0.63, -0.34, 0.71],[-0.18, -0.05, -0.28, 0.03, 0.39, 0.14, -0.21],[-0.08, -0.02, -0.02, -0.08, 0.20, 0.19, -0.04],[1.05, -0.09, -0.46, -0.19, -0.04, -0.16, -0.17],[-0.29, 0.19, -0.33, 0.32, 0.39, 0.14, -0.32],[-0.01, -0.01, 0.20, -0.05, -0.07, -0.02, -0.01]]},
+ {"i": 8,"j": 117, "score": 0.52, "iC": "DSTGA", "jC": "DEKRHSTGAVILY", "matrix": [[-0.02, -0.17, -0.20, -0.10, 0.38, -0.07, 0.17, 0.35, -0.09, -0.21, -0.15, 0.07, 0.18],[0.01, -0.00, 0.08, 0.03, -0.14, -0.05, 0.06, -0.21, 0.02, 0.23, 0.22, -0.23, -0.01],[0.01, 0.07, -0.00, -0.01, -0.18, 0.20, 0.36, -0.11, -0.04, -0.04, 0.04, -0.14, -0.05],[0.10, 0.04, -0.12, -0.08, -0.03, 0.09, -0.29, 0.02, -0.04, 0.14, 0.00, -0.02, 0.04],[-0.17, 0.06, 0.09, 0.18, -0.03, -0.25, -0.25, 0.07, 0.16, -0.08, -0.05, 0.32, -0.12]]},
+ {"i": 8,"j": 118, "score": 0.49, "iC": "DSTGA", "jC": "DRHNSAV", "matrix": [[-0.42, 0.34, 0.06, -0.26, 0.06, 0.18, 0.11],[-0.02, -0.11, 0.18, 0.19, -0.21, -0.39, 0.22],[0.20, -0.11, -0.00, 0.06, -0.19, -0.02, -0.01],[0.01, -0.03, -0.03, -0.00, 0.38, 0.15, -0.16],[0.29, -0.06, -0.25, -0.03, 0.01, 0.04, -0.11]]},
+ {"i": 8,"j": 119, "score": 1.02, "iC": "DNSTGA", "jC": "HPAVILFY", "matrix": [[0.31, -0.47, 0.09, -0.11, -0.40, -0.20, 0.51, 0.28],[-0.02, -0.09, 0.03, 0.09, -0.04, -0.01, -0.18, -0.05],[-0.08, -0.44, -0.21, 0.16, 0.45, 0.08, -0.09, -0.02],[-0.12, -0.21, 0.15, -0.10, 0.21, 0.33, -0.29, 0.04],[-0.03, 0.47, 0.04, -0.35, -0.24, -0.14, 0.19, -0.19],[-0.12, 0.54, -0.01, 0.29, -0.09, -0.20, 0.03, 0.06]]},
+ {"i": 8,"j": 121, "score": 0.48, "iC": "DSTGAC", "jC": "GAC", "matrix": [[-0.26, 0.05, 0.21],[0.21, -0.18, -0.16],[0.16, -0.12, 0.07],[-0.33, 0.45, -0.07],[0.38, 0.01, -0.12],[-0.13, -0.06, 0.17]]},
+ {"i": 9,"j": 8, "score": 0.49, "iC": "DRHNTPAL", "jC": "DSTAC", "matrix": [[-0.09, 0.11, -0.10, 0.22, 0.06],[0.28, -0.10, -0.11, -0.10, -0.06],[-0.05, -0.20, -0.08, 0.23, -0.01],[-0.06, -0.18, -0.10, 0.23, 0.16],[-0.18, 0.17, 0.13, -0.19, 0.02],[-0.08, -0.12, 0.42, -0.45, 0.05],[-0.04, -0.10, -0.08, 0.20, -0.07],[0.13, 0.15, -0.01, -0.30, -0.05]]},
+ {"i": 9,"j": 10, "score": 0.55, "iC": "EKRHQNPAL", "jC": "DEKNSTA", "matrix": [[-0.31, -0.09, 0.23, 0.24, -0.07, -0.09, 0.19],[-0.08, -0.07, -0.27, 0.29, -0.01, 0.17, -0.01],[0.03, -0.01, -0.19, 0.27, -0.06, -0.02, -0.13],[0.18, 0.05, 0.01, -0.17, -0.05, 0.03, -0.06],[-0.12, -0.08, -0.01, 0.08, -0.01, -0.02, 0.18],[-0.04, 0.15, 0.03, -0.05, -0.11, -0.08, -0.07],[0.17, 0.16, -0.04, -0.56, 0.16, -0.02, 0.00],[-0.16, 0.13, 0.02, 0.11, -0.01, -0.05, -0.02],[0.29, -0.07, -0.07, -0.03, -0.03, 0.05, -0.05]]},
+ {"i": 9,"j": 114, "score": 0.41, "iC": "DEKRQAL", "jC": "DEKRHQVILWY", "matrix": [[-0.07, -0.21, 0.14, 0.30, 0.27, 0.06, -0.13, -0.13, -0.07, -0.01, 0.00],[-0.17, -0.39, 0.20, 0.22, -0.17, -0.19, 0.21, 0.16, 0.02, -0.07, -0.01],[0.01, 0.22, -0.22, -0.15, -0.12, -0.05, -0.07, 0.15, 0.03, 0.00, 0.17],[0.17, 0.25, -0.10, -0.11, 0.01, -0.10, -0.09, -0.10, 0.14, 0.18, -0.10],[-0.01, 0.17, 0.02, -0.09, 0.05, 0.04, -0.02, 0.00, -0.03, -0.04, -0.02],[0.02, -0.04, 0.03, 0.03, 0.04, 0.15, -0.04, 0.01, -0.17, -0.00, -0.08],[-0.05, -0.21, -0.08, 0.00, -0.15, 0.14, 0.12, 0.06, 0.24, 0.02, -0.01]]},
+ {"i": 9,"j": 116, "score": 1.86, "iC": "DEKRHQNPAL", "jC": "DEKRHQNPALF", "matrix": [[-0.56, -0.13, 0.09, 0.20, 0.82, -0.08, -0.10, 0.03, -0.08, -0.11, -0.05],[-1.16, -0.49, 0.41, 0.27, 0.76, -0.10, -0.23, 0.15, 0.15, -0.02, 0.15],[0.86, 0.18, -0.21, -0.13, -0.39, 0.02, 0.11, -0.05, -0.09, -0.08, -0.06],[0.93, 0.43, -0.20, -0.09, -0.54, -0.12, 0.02, 0.12, -0.17, -0.14, 0.02],[0.36, -0.01, -0.02, 0.01, -0.16, 0.02, -0.08, -0.02, -0.06, -0.02, -0.01],[-0.29, 0.10, 0.03, -0.08, -0.05, 0.09, -0.17, 0.00, 0.05, 0.21, -0.01],[0.41, -0.17, -0.12, -0.08, -0.23, -0.10, 0.27, -0.01, -0.03, 0.04, -0.03],[-0.22, 0.04, 0.03, 0.00, 0.07, 0.09, -0.05, 0.01, -0.03, -0.09, 0.09],[0.02, -0.11, -0.02, -0.04, -0.05, 0.01, -0.07, -0.01, 0.28, -0.07, -0.08],[-0.31, 0.01, 0.05, 0.04, -0.20, 0.30, 0.19, -0.07, -0.03, 0.01, 0.01]]},
+ {"i": 9,"j": 117, "score": 0.52, "iC": "DEKRQNSPAL", "jC": "EKRHQNTGAIL", "matrix": [[-0.16, -0.10, -0.04, -0.10, -0.01, 0.05, 0.15, 0.41, -0.29, 0.03, 0.03],[-0.03, -0.04, -0.04, 0.25, -0.08, -0.04, -0.10, 0.51, 0.08, -0.17, -0.05],[0.21, -0.12, -0.24, 0.03, -0.15, 0.03, 0.02, -0.15, -0.03, 0.15, 0.08],[0.19, -0.15, -0.09, -0.05, -0.15, -0.16, 0.07, -0.14, 0.12, 0.04, 0.10],[-0.03, 0.15, -0.00, -0.11, 0.08, -0.08, 0.06, -0.17, 0.14, -0.03, 0.03],[-0.05, -0.20, -0.09, 0.04, -0.06, 0.01, 0.06, -0.15, 0.07, 0.04, 0.19],[0.03, 0.15, 0.16, -0.06, 0.04, 0.05, -0.07, 0.16, -0.15, 0.09, -0.10],[-0.07, 0.26, 0.10, 0.01, 0.12, -0.01, -0.03, -0.18, -0.15, -0.04, -0.11],[0.01, 0.10, 0.15, -0.01, 0.14, -0.05, -0.10, -0.06, 0.10, -0.09, -0.05],[-0.02, 0.09, -0.04, -0.08, 0.03, 0.11, 0.10, -0.18, 0.15, -0.04, -0.08]]},
+ {"i": 9,"j": 118, "score": 1.11, "iC": "DEKRQNSAL", "jC": "DEKRHQSTPA", "matrix": [[-0.16, -0.28, 0.10, -0.05, 0.07, 0.05, 0.20, 0.10, -0.00, -0.06],[-0.66, -0.60, 0.40, 0.33, 0.07, 0.08, 0.25, 0.15, -0.05, 0.06],[0.15, 0.53, -0.15, -0.19, -0.13, -0.08, -0.01, -0.25, -0.05, 0.11],[0.61, 0.57, -0.10, -0.34, -0.13, -0.15, -0.19, -0.19, -0.17, 0.01],[-0.06, -0.29, 0.07, 0.08, -0.09, 0.06, 0.05, 0.20, -0.07, -0.02],[0.53, -0.04, -0.15, -0.03, -0.00, -0.11, 0.05, 0.09, -0.01, -0.23],[0.05, 0.02, -0.04, 0.04, -0.04, 0.00, -0.09, -0.15, 0.17, 0.09],[-0.07, -0.01, -0.02, -0.10, -0.02, 0.05, 0.10, 0.16, 0.04, -0.06],[-0.29, -0.06, 0.02, 0.17, 0.17, 0.02, -0.14, 0.09, 0.03, 0.06]]},
+ {"i": 10,"j": 8, "score": 1.06, "iC": "DEKRHQNSTGA", "jC": "DNSTGA", "matrix": [[-0.68, 0.06, -0.03, 0.12, 0.12, 0.24],[-0.02, -0.01, -0.08, 0.21, -0.01, -0.14],[0.38, 0.00, -0.18, 0.12, -0.15, -0.12],[0.33, -0.02, -0.07, -0.05, -0.04, -0.17],[0.20, 0.00, -0.07, -0.14, 0.03, 0.01],[0.18, 0.16, -0.12, 0.05, 0.00, -0.18],[-0.33, -0.25, 0.51, -0.46, 0.23, 0.47],[-0.16, -0.03, 0.15, 0.18, -0.05, -0.12],[-0.09, 0.05, 0.07, 0.11, -0.05, -0.16],[-0.21, -0.03, -0.07, -0.20, 0.00, 0.38],[0.34, -0.03, -0.02, 0.08, -0.06, -0.25]]},
+ {"i": 10,"j": 9, "score": 0.55, "iC": "DEKNSTA", "jC": "EKRHQNPAL", "matrix": [[-0.31, -0.08, 0.03, 0.18, -0.12, -0.04, 0.17, -0.16, 0.29],[-0.09, -0.07, -0.01, 0.05, -0.08, 0.15, 0.16, 0.13, -0.07],[0.23, -0.27, -0.19, 0.01, -0.01, 0.03, -0.04, 0.02, -0.07],[0.24, 0.29, 0.27, -0.17, 0.08, -0.05, -0.56, 0.11, -0.03],[-0.07, -0.01, -0.06, -0.05, -0.01, -0.11, 0.16, -0.01, -0.03],[-0.09, 0.17, -0.02, 0.03, -0.02, -0.08, -0.02, -0.05, 0.05],[0.19, -0.01, -0.13, -0.06, 0.18, -0.07, 0.00, -0.02, -0.05]]},
+ {"i": 10,"j": 118, "score": 0.91, "iC": "DEKRQNSTA", "jC": "DEKRHNSTA", "matrix": [[-0.57, -0.48, 0.30, 0.27, 0.32, 0.05, 0.25, -0.06, -0.01],[-0.21, -0.30, 0.02, -0.04, 0.09, 0.16, 0.08, 0.02, -0.01],[0.50, 0.33, -0.14, -0.15, -0.06, -0.05, -0.15, -0.10, -0.08],[0.18, 0.07, -0.07, -0.02, -0.02, -0.05, -0.06, -0.00, -0.07],[-0.09, -0.05, 0.03, -0.10, -0.07, 0.03, 0.13, 0.19, 0.08],[0.02, 0.23, -0.16, -0.30, -0.13, -0.10, 0.15, -0.07, 0.37],[0.17, 0.29, -0.05, 0.07, -0.06, 0.04, -0.09, -0.15, -0.06],[0.12, -0.19, 0.00, -0.02, -0.03, 0.03, -0.01, 0.02, 0.02],[-0.01, -0.09, 0.01, 0.25, -0.10, -0.04, -0.13, 0.18, -0.16]]},
+ {"i": 11,"j": 7, "score": 1.40, "iC": "DRHQNGLWY", "jC": "EKRHQAVILMY", "matrix": [[-0.03, 0.06, -0.04, -0.02, -0.01, 0.27, -0.00, -0.05, -0.07, -0.06, -0.02],[0.01, -0.29, -0.46, 0.22, 0.16, -0.55, -0.57, -0.07, 0.12, 1.00, 0.35],[0.45, 0.04, 0.02, -0.01, -0.21, -0.11, -0.32, -0.06, 0.28, -0.01, 0.04],[0.02, -0.02, -0.04, -0.06, -0.05, -0.02, -0.03, -0.03, -0.03, 0.19, 0.04],[-0.17, 0.43, 0.02, -0.14, -0.10, 0.25, 0.10, 0.14, -0.06, -0.27, -0.21],[-0.12, -0.08, 0.56, -0.22, 0.32, -0.07, 0.35, 0.19, -0.38, -0.41, -0.21],[-0.05, -0.03, -0.06, 0.14, -0.06, 0.05, 0.15, -0.03, -0.04, -0.16, -0.02],[-0.04, -0.02, -0.05, -0.01, -0.06, 0.18, 0.22, -0.09, -0.06, -0.01, -0.01],[-0.04, -0.03, 0.04, 0.01, -0.06, -0.06, -0.06, 0.06, 0.17, -0.11, 0.01]]},
+ {"i": 11,"j": 114, "score": 0.53, "iC": "DKRNGWY", "jC": "EKRVIL", "matrix": [[-0.15, -0.06, 0.42, -0.05, -0.03, -0.02],[0.18, -0.00, -0.12, 0.11, -0.06, -0.03],[0.22, -0.30, -0.36, 0.30, 0.07, 0.18],[-0.15, 0.04, 0.58, -0.10, -0.11, -0.02],[0.15, 0.09, -0.16, 0.08, 0.07, -0.08],[-0.27, 0.18, 0.07, -0.09, -0.03, -0.01],[-0.07, 0.04, -0.21, 0.07, 0.15, -0.03]]},
+ {"i": 11,"j": 127, "score": 0.63, "iC": "DKRQNGLMFWY", "jC": "DEKRNTAVL", "matrix": [[-0.10, -0.20, 0.15, 0.01, -0.04, -0.02, 0.08, -0.04, -0.02],[0.20, 0.06, -0.11, 0.03, 0.07, -0.02, -0.06, -0.03, -0.02],[0.15, 0.70, -0.35, -0.19, -0.15, -0.19, -0.04, 0.14, -0.01],[-0.15, -0.06, 0.01, -0.02, -0.02, 0.12, 0.07, 0.12, -0.03],[0.15, 0.21, -0.08, -0.05, -0.01, 0.04, -0.12, -0.01, 0.01],[0.09, -0.21, 0.05, -0.05, -0.12, 0.10, -0.13, -0.23, 0.21],[-0.09, -0.10, 0.02, 0.00, 0.06, -0.02, 0.19, -0.02, -0.02],[-0.16, -0.06, 0.05, 0.11, 0.10, -0.04, 0.02, 0.02, 0.01],[-0.05, -0.16, 0.08, 0.08, 0.05, -0.04, -0.10, 0.04, 0.01],[0.08, -0.13, 0.02, 0.04, 0.25, -0.06, 0.04, -0.04, -0.04],[-0.12, -0.12, 0.23, 0.05, -0.09, 0.06, 0.01, -0.03, -0.02]]},
+ {"i": 11,"j": 128, "score": 0.37, "iC": "RNGWY", "jC": "PVILFWY", "matrix": [[-0.19, -0.15, -0.19, 0.09, 0.07, 0.19, 0.47],[-0.07, -0.03, 0.26, 0.12, -0.01, -0.10, -0.13],[0.22, 0.14, -0.06, -0.23, -0.24, -0.04, -0.26],[0.02, -0.07, 0.01, 0.29, -0.06, -0.06, -0.09],[0.07, -0.05, -0.07, -0.00, 0.22, -0.03, -0.07]]},
+ {"i": 12,"j": 8, "score": 1.44, "iC": "ETGAVIL", "jC": "DSTGAC", "matrix": [[-0.42, -0.18, -0.08, 1.05, -0.29, -0.01],[-0.03, -0.05, -0.02, -0.09, 0.19, -0.01],[0.59, -0.28, -0.02, -0.46, -0.33, 0.20],[-0.01, 0.03, -0.08, -0.19, 0.32, -0.05],[-0.63, 0.39, 0.20, -0.04, 0.39, -0.07],[-0.34, 0.14, 0.19, -0.16, 0.14, -0.02],[0.71, -0.21, -0.04, -0.17, -0.32, -0.01]]},
+ {"i": 12,"j": 20, "score": 0.41, "iC": "EGAVL", "jC": "PIL", "matrix": [[-0.26, 0.08, 0.14],[0.07, -0.20, 0.17],[-0.20, -0.02, 0.29],[0.13, 0.19, -0.43],[0.19, -0.03, -0.11]]},
+ {"i": 12,"j": 121, "score": 2.15, "iC": "ETGAVILC", "jC": "GAVC", "matrix": [[-0.46, 0.50, 0.01, -0.02],[0.29, -0.16, -0.02, -0.04],[-1.33, 0.23, 0.22, 0.70],[-0.63, 0.93, -0.01, -0.19],[1.08, -0.89, -0.07, -0.24],[0.37, -0.31, -0.05, -0.07],[0.42, -0.35, -0.06, -0.10],[0.16, -0.17, -0.02, 0.07]]},
+ {"i": 12,"j": 124, "score": 1.11, "iC": "TGAVILC", "jC": "KRHQSTAVLFWY", "matrix": [[0.02, -0.03, 0.18, 0.14, 0.02, 0.02, -0.02, 0.00, -0.04, -0.05, -0.08, -0.19],[-0.12, -0.04, 0.11, 0.02, -0.00, -0.08, -0.04, -0.05, -0.04, 0.50, -0.08, -0.17],[-0.15, -0.20, -0.05, -0.03, -0.10, -0.17, -0.02, -0.13, -0.08, 0.71, 0.17, 0.21],[-0.09, 0.07, 0.01, -0.27, -0.31, 0.14, -0.16, 0.20, 0.21, -0.11, 0.03, 0.07],[0.07, 0.15, -0.23, 0.16, 0.44, 0.09, 0.08, 0.10, 0.04, -0.60, -0.11, -0.17],[-0.16, -0.02, 0.15, -0.05, -0.06, -0.08, 0.01, -0.09, -0.07, -0.35, 0.23, 0.55],[-0.01, -0.03, -0.03, -0.02, 0.00, -0.03, -0.01, -0.03, -0.03, 0.29, -0.04, -0.04]]},
+ {"i": 13,"j": 5, "score": 0.60, "iC": "IL", "jC": "AV", "matrix": [[-0.24, 0.38],[0.45, -0.53]]},
+ {"i": 15,"j": 16, "score": 2.01, "iC": "DKRHQNSAVILFY", "jC": "DEKRHQNSGA", "matrix": [[-0.37, -0.23, 0.15, 0.15, -0.01, -0.08, -0.26, 0.19, 0.37, 0.03],[1.28, 0.06, -0.74, -0.39, -0.37, -0.29, 0.07, 0.08, 0.36, 0.10],[0.72, -0.07, -0.34, -0.19, -0.01, -0.19, 0.07, -0.04, -0.05, 0.01],[-0.32, 0.11, 0.04, -0.02, -0.02, 0.27, -0.07, 0.04, -0.09, 0.03],[-0.14, -0.13, -0.13, -0.00, -0.04, -0.02, 0.12, -0.02, 0.19, 0.18],[-0.44, 0.06, 0.41, 0.10, 0.08, 0.16, -0.33, -0.05, -0.01, 0.04],[-0.19, 0.01, 0.03, -0.05, -0.00, -0.03, 0.03, 0.07, 0.09, 0.04],[-0.08, -0.14, -0.02, -0.00, 0.06, -0.09, 0.23, 0.03, -0.03, -0.07],[0.28, -0.00, -0.02, -0.01, -0.02, -0.16, 0.12, -0.02, -0.23, 0.05],[0.21, -0.04, -0.11, -0.01, -0.00, -0.18, 0.36, -0.05, -0.09, -0.09],[0.06, -0.16, 0.03, 0.07, 0.11, -0.19, 0.52, -0.09, -0.20, -0.13],[-0.31, 0.41, 0.15, 0.09, 0.03, 0.20, -0.29, -0.05, -0.11, -0.11],[-0.64, 0.04, 0.53, 0.25, 0.05, 0.70, -0.46, -0.06, -0.24, -0.12]]},
+ {"i": 15,"j": 18, "score": 0.39, "iC": "KRTAVILF", "jC": "DKRHQTGAV", "matrix": [[0.04, -0.22, -0.17, -0.12, 0.04, 0.11, -0.11, 0.16, 0.16],[0.36, -0.31, -0.39, -0.08, 0.09, 0.11, 0.08, 0.07, -0.08],[-0.06, -0.05, -0.04, -0.00, -0.03, -0.05, 0.16, 0.05, 0.02],[0.16, 0.01, -0.02, -0.11, -0.18, -0.00, 0.12, 0.20, 0.01],[-0.17, 0.06, 0.17, 0.01, -0.00, 0.08, 0.06, -0.21, -0.06],[-0.09, -0.03, 0.21, 0.17, -0.12, 0.16, 0.02, -0.29, -0.02],[-0.07, 0.22, -0.00, 0.00, 0.03, -0.12, 0.01, -0.05, 0.07],[-0.05, 0.19, 0.06, 0.06, -0.04, -0.05, -0.02, -0.05, -0.03]]},
+ {"i": 15,"j": 20, "score": 0.37, "iC": "KGVI", "jC": "PL", "matrix": [[-0.35, 0.03],[-0.30, 0.38],[0.26, -0.17],[0.35, -0.23]]},
+ {"i": 15,"j": 120, "score": 1.18, "iC": "DKRHNAILFY", "jC": "DEKRQSTPGA", "matrix": [[-0.09, -0.24, 0.08, 0.15, 0.01, 0.25, 0.04, -0.05, -0.06, -0.02],[0.94, 0.35, -0.40, -0.20, -0.33, -0.19, -0.16, -0.24, 0.54, -0.16],[0.62, 0.28, -0.15, -0.15, -0.09, -0.08, -0.06, -0.11, 0.12, -0.15],[-0.27, 0.04, 0.03, 0.01, 0.15, -0.09, -0.01, 0.16, -0.05, -0.05],[-0.11, 0.21, -0.08, -0.01, -0.11, 0.02, 0.04, 0.07, -0.11, 0.12],[-0.18, -0.19, -0.08, 0.01, 0.13, 0.08, 0.05, 0.10, -0.06, 0.14],[-0.06, -0.01, 0.16, -0.03, -0.00, 0.02, 0.05, -0.15, -0.09, 0.08],[-0.33, 0.11, 0.23, 0.02, 0.05, -0.07, -0.09, 0.03, -0.11, 0.03],[-0.13, 0.03, 0.03, -0.03, 0.25, -0.10, -0.04, 0.05, 0.00, -0.04],[-0.33, -0.37, 0.27, 0.00, 0.07, -0.00, 0.00, 0.29, -0.15, -0.17]]},
+ {"i": 16,"j": 15, "score": 2.01, "iC": "DEKRHQNSGA", "jC": "DKRHQNSAVILFY", "matrix": [[-0.37, 1.28, 0.72, -0.32, -0.14, -0.44, -0.19, -0.08, 0.28, 0.21, 0.06, -0.31, -0.64],[-0.23, 0.06, -0.07, 0.11, -0.13, 0.06, 0.01, -0.14, -0.00, -0.04, -0.16, 0.41, 0.04],[0.15, -0.74, -0.34, 0.04, -0.13, 0.41, 0.03, -0.02, -0.02, -0.11, 0.03, 0.15, 0.53],[0.15, -0.39, -0.19, -0.02, -0.00, 0.10, -0.05, -0.00, -0.01, -0.01, 0.07, 0.09, 0.25],[-0.01, -0.37, -0.01, -0.02, -0.04, 0.08, -0.00, 0.06, -0.02, -0.00, 0.11, 0.03, 0.05],[-0.08, -0.29, -0.19, 0.27, -0.02, 0.16, -0.03, -0.09, -0.16, -0.18, -0.19, 0.20, 0.70],[-0.26, 0.07, 0.07, -0.07, 0.12, -0.33, 0.03, 0.23, 0.12, 0.36, 0.52, -0.29, -0.46],[0.19, 0.08, -0.04, 0.04, -0.02, -0.05, 0.07, 0.03, -0.02, -0.05, -0.09, -0.05, -0.06],[0.37, 0.36, -0.05, -0.09, 0.19, -0.01, 0.09, -0.03, -0.23, -0.09, -0.20, -0.11, -0.24],[0.03, 0.10, 0.01, 0.03, 0.18, 0.04, 0.04, -0.07, 0.05, -0.09, -0.13, -0.11, -0.12]]},
+ {"i": 16,"j": 17, "score": 0.62, "iC": "DKQNGA", "jC": "NTPG", "matrix": [[0.47, -0.11, -0.06, -0.02],[-0.07, 0.01, -0.02, 0.16],[-0.20, -0.00, -0.01, 0.20],[0.23, -0.03, -0.03, -0.11],[-0.29, 0.16, 0.19, -0.63],[-0.19, 0.01, -0.02, 0.27]]},
+ {"i": 16,"j": 18, "score": 0.73, "iC": "DEKRHQNGA", "jC": "DEKRHQNTGA", "matrix": [[0.11, -0.24, 0.34, -0.10, 0.19, -0.04, -0.05, -0.29, 0.08, -0.06],[-0.17, -0.14, 0.21, 0.44, 0.08, -0.23, 0.05, -0.18, 0.16, -0.16],[0.02, 0.17, -0.23, 0.08, -0.13, 0.07, -0.02, 0.03, 0.03, -0.02],[0.01, 0.10, -0.10, -0.07, -0.04, 0.03, -0.03, 0.04, -0.05, 0.15],[-0.05, -0.04, -0.08, 0.02, 0.08, 0.01, -0.01, 0.19, -0.11, -0.01],[-0.11, -0.11, 0.26, 0.10, 0.06, 0.11, -0.00, -0.12, -0.04, -0.10],[0.08, 0.39, -0.42, -0.37, -0.15, 0.20, -0.08, 0.22, -0.17, -0.07],[0.27, -0.02, 0.18, -0.08, -0.10, -0.09, 0.15, -0.05, -0.29, 0.16],[-0.10, -0.06, -0.12, 0.07, 0.04, -0.02, -0.05, -0.01, 0.19, 0.06]]},
+ {"i": 17,"j": 16, "score": 0.62, "iC": "NTPG", "jC": "DKQNGA", "matrix": [[0.47, -0.07, -0.20, 0.23, -0.29, -0.19],[-0.11, 0.01, -0.00, -0.03, 0.16, 0.01],[-0.06, -0.02, -0.01, -0.03, 0.19, -0.02],[-0.02, 0.16, 0.20, -0.11, -0.63, 0.27]]},
+ {"i": 17,"j": 18, "score": 0.38, "iC": "NPG", "jC": "DRQSGAV", "matrix": [[-0.04, 0.14, 0.22, 0.14, -0.33, 0.22, -0.28],[0.19, -0.01, -0.03, -0.02, -0.03, -0.04, -0.00],[-0.05, -0.21, -0.16, -0.23, 0.31, -0.25, 0.21]]},
+ {"i": 17,"j": 44, "score": 0.47, "iC": "KNG", "jC": "KNTGAVL", "matrix": [[-0.16, 0.07, 0.08, -0.01, 0.01, 0.01, 0.00],[0.14, 0.35, -0.39, -0.13, -0.21, -0.26, 0.19],[0.09, -0.33, 0.14, 0.16, 0.20, 0.11, -0.11]]},
+ {"i": 17,"j": 48, "score": 0.54, "iC": "NG", "jC": "DESTG", "matrix": [[-0.09, -0.13, 0.66, -0.26, -0.17],[0.15, 0.23, -0.17, -0.05, 0.03]]},
+ {"i": 17,"j": 122, "score": 0.38, "iC": "NTG", "jC": "D", "matrix": [[0.22],[-0.15],[0.43]]},
+ {"i": 18,"j": 15, "score": 0.39, "iC": "DKRHQTGAV", "jC": "KRTAVILF", "matrix": [[0.04, 0.36, -0.06, 0.16, -0.17, -0.09, -0.07, -0.05],[-0.22, -0.31, -0.05, 0.01, 0.06, -0.03, 0.22, 0.19],[-0.17, -0.39, -0.04, -0.02, 0.17, 0.21, -0.00, 0.06],[-0.12, -0.08, -0.00, -0.11, 0.01, 0.17, 0.00, 0.06],[0.04, 0.09, -0.03, -0.18, -0.00, -0.12, 0.03, -0.04],[0.11, 0.11, -0.05, -0.00, 0.08, 0.16, -0.12, -0.05],[-0.11, 0.08, 0.16, 0.12, 0.06, 0.02, 0.01, -0.02],[0.16, 0.07, 0.05, 0.20, -0.21, -0.29, -0.05, -0.05],[0.16, -0.08, 0.02, 0.01, -0.06, -0.02, 0.07, -0.03]]},
+ {"i": 18,"j": 16, "score": 0.73, "iC": "DEKRHQNTGA", "jC": "DEKRHQNGA", "matrix": [[0.11, -0.17, 0.02, 0.01, -0.05, -0.11, 0.08, 0.27, -0.10],[-0.24, -0.14, 0.17, 0.10, -0.04, -0.11, 0.39, -0.02, -0.06],[0.34, 0.21, -0.23, -0.10, -0.08, 0.26, -0.42, 0.18, -0.12],[-0.10, 0.44, 0.08, -0.07, 0.02, 0.10, -0.37, -0.08, 0.07],[0.19, 0.08, -0.13, -0.04, 0.08, 0.06, -0.15, -0.10, 0.04],[-0.04, -0.23, 0.07, 0.03, 0.01, 0.11, 0.20, -0.09, -0.02],[-0.05, 0.05, -0.02, -0.03, -0.01, -0.00, -0.08, 0.15, -0.05],[-0.29, -0.18, 0.03, 0.04, 0.19, -0.12, 0.22, -0.05, -0.01],[0.08, 0.16, 0.03, -0.05, -0.11, -0.04, -0.17, -0.29, 0.19],[-0.06, -0.16, -0.02, 0.15, -0.01, -0.10, -0.07, 0.16, 0.06]]},
+ {"i": 18,"j": 17, "score": 0.38, "iC": "DRQSGAV", "jC": "NPG", "matrix": [[-0.04, 0.19, -0.05],[0.14, -0.01, -0.21],[0.22, -0.03, -0.16],[0.14, -0.02, -0.23],[-0.33, -0.03, 0.31],[0.22, -0.04, -0.25],[-0.28, -0.00, 0.21]]},
+ {"i": 19,"j": 20, "score": 0.59, "iC": "IL", "jC": "PL", "matrix": [[0.53, -0.36],[-0.46, 0.40]]},
+ {"i": 19,"j": 22, "score": 0.39, "iC": "QILM", "jC": "RHGFY", "matrix": [[-0.10, -0.11, -0.01, 0.09, 0.18],[0.16, -0.15, -0.10, 0.05, 0.01],[0.28, -0.11, -0.05, -0.16, -0.13],[-0.40, 0.41, 0.18, 0.00, -0.13]]},
+ {"i": 19,"j": 27, "score": 0.71, "iC": "ILM", "jC": "QVLMF", "matrix": [[0.30, 0.17, -0.58, -0.05, -0.05],[-0.28, -0.13, 0.23, 0.43, -0.35],[-0.07, -0.07, 0.27, -0.27, 0.41]]},
+ {"i": 20,"j": 12, "score": 0.41, "iC": "PIL", "jC": "EGAVL", "matrix": [[-0.26, 0.07, -0.20, 0.13, 0.19],[0.08, -0.20, -0.02, 0.19, -0.03],[0.14, 0.17, 0.29, -0.43, -0.11]]},
+ {"i": 20,"j": 15, "score": 0.37, "iC": "PL", "jC": "KGVI", "matrix": [[-0.35, -0.30, 0.26, 0.35],[0.03, 0.38, -0.17, -0.23]]},
+ {"i": 20,"j": 19, "score": 0.59, "iC": "PL", "jC": "IL", "matrix": [[0.53, -0.46],[-0.36, 0.40]]},
+ {"i": 20,"j": 21, "score": 0.87, "iC": "PL", "jC": "CWY", "matrix": [[-0.21, 0.76, -0.20],[0.24, -0.67, 0.02]]},
+ {"i": 20,"j": 119, "score": 0.50, "iC": "PIL", "jC": "KPVIF", "matrix": [[-0.21, -0.12, 0.47, 0.38, -0.22],[-0.04, 0.15, -0.16, -0.25, 0.07],[0.19, -0.17, -0.31, -0.10, 0.15]]},
+ {"i": 20,"j": 121, "score": 0.39, "iC": "PL", "jC": "GAC", "matrix": [[0.23, -0.38, 0.17],[-0.30, 0.40, -0.17]]},
+ {"i": 21,"j": 20, "score": 0.87, "iC": "CWY", "jC": "PL", "matrix": [[-0.21, 0.24],[0.76, -0.67],[-0.20, 0.02]]},
+ {"i": 21,"j": 115, "score": 0.50, "iC": "CFW", "jC": "VIL", "matrix": [[-0.32, 0.27, 0.02],[0.30, -0.24, -0.07],[0.31, -0.08, 0.15]]},
+ {"i": 21,"j": 119, "score": 0.38, "iC": "ACFWY", "jC": "PAF", "matrix": [[-0.02, -0.02, 0.17],[-0.03, -0.04, 0.33],[-0.07, 0.21, -0.32],[-0.12, -0.07, 0.19],[0.21, -0.02, -0.28]]},
+ {"i": 22,"j": 19, "score": 0.39, "iC": "RHGFY", "jC": "QILM", "matrix": [[-0.10, 0.16, 0.28, -0.40],[-0.11, -0.15, -0.11, 0.41],[-0.01, -0.10, -0.05, 0.18],[0.09, 0.05, -0.16, 0.00],[0.18, 0.01, -0.13, -0.13]]},
+ {"i": 22,"j": 24, "score": 0.52, "iC": "DKRHNSPGAY", "jC": "KRSP", "matrix": [[-0.04, -0.05, -0.15, 0.33],[0.02, -0.15, 0.28, -0.30],[0.04, 0.02, 0.19, -0.15],[-0.26, -0.12, 0.17, 0.09],[-0.02, -0.06, -0.11, 0.28],[-0.07, 0.01, -0.06, 0.19],[0.15, 0.13, -0.12, -0.38],[0.17, 0.02, -0.05, -0.12],[0.09, 0.06, 0.05, -0.16],[-0.05, -0.07, -0.10, 0.27]]},
+ {"i": 22,"j": 27, "score": 0.76, "iC": "DKRHNPAY", "jC": "RQLMF", "matrix": [[0.37, -0.13, -0.08, -0.14, -0.11],[-0.06, 0.10, -0.12, 0.25, -0.11],[-0.15, 0.08, -0.16, 0.08, -0.19],[-0.19, -0.17, 0.38, -0.16, 0.63],[0.05, -0.04, -0.16, 0.14, -0.03],[0.04, 0.01, -0.22, -0.05, 0.14],[0.04, 0.03, -0.16, 0.17, -0.03],[-0.02, -0.11, 0.54, -0.32, -0.00]]},
+ {"i": 23,"j": 115, "score": 0.63, "iC": "VILMC", "jC": "VIL", "matrix": [[-0.39, -0.07, 0.31],[0.44, -0.07, -0.08],[0.39, -0.02, -0.24],[-0.24, 0.20, -0.02],[-0.21, 0.05, 0.15]]},
+ {"i": 23,"j": 146, "score": 0.36, "iC": "VILM", "jC": "HNG", "matrix": [[-0.06, -0.25, 0.10],[-0.27, -0.20, 0.15],[0.32, 0.42, -0.06],[0.03, 0.30, -0.04]]},
+ {"i": 24,"j": 22, "score": 0.52, "iC": "KRSP", "jC": "DKRHNSPGAY", "matrix": [[-0.04, 0.02, 0.04, -0.26, -0.02, -0.07, 0.15, 0.17, 0.09, -0.05],[-0.05, -0.15, 0.02, -0.12, -0.06, 0.01, 0.13, 0.02, 0.06, -0.07],[-0.15, 0.28, 0.19, 0.17, -0.11, -0.06, -0.12, -0.05, 0.05, -0.10],[0.33, -0.30, -0.15, 0.09, 0.28, 0.19, -0.38, -0.12, -0.16, 0.27]]},
+ {"i": 24,"j": 28, "score": 0.81, "iC": "KRSP", "jC": "KRQAIL", "matrix": [[-0.61, -0.21, 0.14, 0.23, 0.04, 0.10],[-0.30, 0.05, 0.29, -0.23, 0.11, 0.08],[0.57, 0.09, 0.00, -0.31, 0.04, 0.01],[0.20, -0.01, -0.26, 0.42, -0.18, -0.19]]},
+ {"i": 24,"j": 145, "score": 0.58, "iC": "KRSP", "jC": "DEKRHGY", "matrix": [[0.42, 0.26, -0.48, -0.15, -0.02, 0.21, -0.04],[0.06, 0.12, -0.06, -0.21, 0.17, 0.01, -0.04],[-0.05, 0.09, 0.32, 0.16, -0.17, -0.06, -0.19],[-0.37, -0.34, 0.11, 0.20, 0.08, -0.17, 0.25]]},
+ {"i": 25,"j": 26, "score": 0.36, "iC": "EKNGA", "jC": "DE", "matrix": [[0.25, -0.26],[-0.15, 0.18],[-0.21, 0.19],[-0.22, 0.21],[0.15, -0.18]]},
+ {"i": 25,"j": 28, "score": 0.37, "iC": "DEKRNGA", "jC": "EKRQPA", "matrix": [[-0.12, 0.21, 0.18, -0.15, 0.02, -0.30],[0.13, 0.08, 0.15, -0.10, -0.09, 0.04],[0.18, -0.46, -0.19, 0.21, -0.02, 0.11],[0.01, -0.18, -0.03, 0.20, -0.01, 0.06],[-0.05, 0.35, -0.12, -0.09, -0.01, -0.12],[-0.03, -0.08, -0.05, -0.02, 0.22, -0.02],[-0.09, -0.15, 0.06, 0.09, -0.06, 0.18]]},
+ {"i": 25,"j": 143, "score": 0.56, "iC": "DEKRNSTGA", "jC": "DEKRQNSTG", "matrix": [[0.04, -0.06, 0.05, 0.11, -0.04, 0.22, 0.02, -0.09, -0.07],[-0.56, -0.15, 0.31, 0.17, -0.31, 0.03, 0.24, 0.18, -0.03],[0.16, 0.03, -0.03, -0.08, -0.02, -0.09, -0.10, -0.00, -0.03],[0.25, 0.05, -0.02, -0.05, 0.04, -0.11, -0.03, -0.01, 0.00],[0.25, 0.10, -0.07, 0.00, 0.05, -0.02, -0.05, 0.00, -0.07],[-0.12, -0.04, -0.02, -0.09, 0.11, -0.08, 0.11, 0.06, 0.16],[-0.12, -0.08, 0.01, -0.05, 0.02, -0.06, 0.01, 0.03, 0.16],[-0.24, 0.07, -0.04, 0.11, 0.05, -0.06, -0.02, -0.03, -0.06],[0.52, -0.03, -0.13, -0.01, 0.15, 0.05, -0.22, -0.12, -0.06]]},
+ {"i": 25,"j": 145, "score": 0.37, "iC": "DEKTA", "jC": "DEKRSTA", "matrix": [[-0.11, -0.35, -0.11, 0.46, -0.06, -0.05, 0.02],[-0.17, -0.31, -0.20, -0.04, 0.24, 0.18, 0.30],[0.08, 0.06, -0.02, -0.15, -0.02, 0.12, -0.08],[0.15, 0.23, 0.03, -0.07, -0.04, -0.05, -0.05],[0.03, -0.02, 0.19, -0.12, 0.04, -0.05, 0.03]]},
+ {"i": 25,"j": 146, "score": 0.65, "iC": "DERNSTA", "jC": "DHNTP", "matrix": [[-0.21, 0.47, -0.32, 0.02, 0.09],[-0.13, -0.27, -0.37, 0.13, 0.15],[-0.02, -0.03, 0.21, -0.01, -0.01],[-0.12, 0.44, -0.09, -0.07, -0.02],[0.45, -0.08, -0.02, -0.05, -0.02],[0.27, -0.10, 0.17, -0.05, -0.02],[-0.20, -0.41, 0.43, 0.18, -0.06]]},
+ {"i": 25,"j": 150, "score": 0.97, "iC": "DEKNSTGA", "jC": "HVLFY", "matrix": [[0.31, -0.03, -0.08, 0.32, -0.28],[-0.34, 0.04, 0.03, 0.22, 0.30],[-0.16, -0.02, 0.05, 0.21, -0.05],[0.53, -0.03, -0.10, -0.63, 0.45],[0.07, 0.03, -0.01, 0.14, -0.25],[-0.06, 0.17, -0.06, 0.11, -0.44],[0.03, -0.04, -0.16, -0.22, 0.48],[-0.30, -0.10, 0.12, -0.21, 0.08]]},
+ {"i": 26,"j": 25, "score": 0.36, "iC": "DE", "jC": "EKNGA", "matrix": [[0.25, -0.15, -0.21, -0.22, 0.15],[-0.26, 0.18, 0.19, 0.21, -0.18]]},
+ {"i": 26,"j": 27, "score": 0.41, "iC": "DE", "jC": "Q", "matrix": [[-0.44],[0.40]]},
+ {"i": 26,"j": 29, "score": 0.40, "iC": "DE", "jC": "FWY", "matrix": [[0.36, 0.14, -0.24],[-0.35, -0.15, 0.27]]},
+ {"i": 26,"j": 152, "score": 0.53, "iC": "DE", "jC": "FY", "matrix": [[0.44, -0.16],[-0.52, 0.14]]},
+ {"i": 27,"j": 19, "score": 0.71, "iC": "QVLMF", "jC": "ILM", "matrix": [[0.30, -0.28, -0.07],[0.17, -0.13, -0.07],[-0.58, 0.23, 0.27],[-0.05, 0.43, -0.27],[-0.05, -0.35, 0.41]]},
+ {"i": 27,"j": 22, "score": 0.76, "iC": "RQLMF", "jC": "DKRHNPAY", "matrix": [[0.37, -0.06, -0.15, -0.19, 0.05, 0.04, 0.04, -0.02],[-0.13, 0.10, 0.08, -0.17, -0.04, 0.01, 0.03, -0.11],[-0.08, -0.12, -0.16, 0.38, -0.16, -0.22, -0.16, 0.54],[-0.14, 0.25, 0.08, -0.16, 0.14, -0.05, 0.17, -0.32],[-0.11, -0.11, -0.19, 0.63, -0.03, 0.14, -0.03, -0.00]]},
+ {"i": 27,"j": 26, "score": 0.41, "iC": "Q", "jC": "DE", "matrix": [[-0.44, 0.40]]},
+ {"i": 27,"j": 29, "score": 0.41, "iC": "QLMF", "jC": "RHFWY", "matrix": [[0.07, -0.35, -0.00, 0.03, -0.18],[0.16, 0.21, -0.22, -0.41, -0.19],[0.03, 0.10, 0.22, 0.03, 0.02],[-0.16, 0.24, -0.05, 0.40, 0.02]]},
+ {"i": 27,"j": 31, "score": 0.41, "iC": "SLMF", "jC": "KRQSTAV", "matrix": [[-0.20, 0.15, 0.05, -0.01, -0.01, -0.01, -0.00],[0.33, -0.23, 0.14, 0.16, -0.12, -0.05, -0.22],[-0.12, 0.04, -0.16, -0.07, 0.24, 0.15, 0.26],[0.24, -0.17, -0.00, -0.03, -0.07, -0.07, 0.04]]},
+ {"i": 28,"j": 24, "score": 0.81, "iC": "KRQAIL", "jC": "KRSP", "matrix": [[-0.61, -0.30, 0.57, 0.20],[-0.21, 0.05, 0.09, -0.01],[0.14, 0.29, 0.00, -0.26],[0.23, -0.23, -0.31, 0.42],[0.04, 0.11, 0.04, -0.18],[0.10, 0.08, 0.01, -0.19]]},
+ {"i": 28,"j": 25, "score": 0.37, "iC": "EKRQPA", "jC": "DEKRNGA", "matrix": [[-0.12, 0.13, 0.18, 0.01, -0.05, -0.03, -0.09],[0.21, 0.08, -0.46, -0.18, 0.35, -0.08, -0.15],[0.18, 0.15, -0.19, -0.03, -0.12, -0.05, 0.06],[-0.15, -0.10, 0.21, 0.20, -0.09, -0.02, 0.09],[0.02, -0.09, -0.02, -0.01, -0.01, 0.22, -0.06],[-0.30, 0.04, 0.11, 0.06, -0.12, -0.02, 0.18]]},
+ {"i": 28,"j": 32, "score": 0.88, "iC": "EKRQGA", "jC": "DEKRNTA", "matrix": [[-0.12, -0.14, 0.02, -0.05, 0.22, 0.13, 0.01],[0.29, 0.36, -0.45, -0.48, -0.14, 0.05, 0.33],[0.16, 0.43, -0.32, -0.39, -0.02, -0.07, 0.02],[0.11, -0.17, 0.15, 0.22, 0.04, -0.04, -0.15],[-0.03, -0.07, -0.04, 0.16, -0.00, 0.02, 0.01],[-0.29, -0.34, 0.51, 0.43, -0.17, -0.18, -0.03]]},
+ {"i": 29,"j": 26, "score": 0.40, "iC": "FWY", "jC": "DE", "matrix": [[0.36, -0.35],[0.14, -0.15],[-0.24, 0.27]]},
+ {"i": 29,"j": 27, "score": 0.41, "iC": "RHFWY", "jC": "QLMF", "matrix": [[0.07, 0.16, 0.03, -0.16],[-0.35, 0.21, 0.10, 0.24],[-0.00, -0.22, 0.22, -0.05],[0.03, -0.41, 0.03, 0.40],[-0.18, -0.19, 0.02, 0.02]]},
+ {"i": 29,"j": 33, "score": 1.55, "iC": "RHQNILFWY", "jC": "KRHQNTVILMC", "matrix": [[-0.27, -0.08, -0.13, -0.12, -0.06, -0.48, -0.18, 0.55, 0.98, -0.00, -0.02],[-0.16, -0.24, -0.02, -0.26, -0.23, 0.37, 0.32, 0.11, 0.12, -0.08, -0.05],[0.00, 0.12, -0.01, -0.03, -0.01, -0.11, -0.04, -0.02, 0.19, -0.04, -0.01],[-0.09, 0.05, -0.01, -0.06, -0.02, -0.14, 0.09, 0.08, 0.18, -0.07, 0.00],[0.00, 0.17, 0.01, -0.02, -0.01, -0.08, -0.01, -0.07, -0.01, 0.03, 0.03],[0.05, -0.01, 0.07, -0.05, 0.00, -0.18, -0.15, -0.00, 0.11, -0.01, -0.02],[0.26, -0.08, -0.14, 0.36, 0.10, 0.77, -0.09, -0.45, -0.87, 0.02, -0.01],[0.10, -0.02, 0.21, 0.15, 0.33, -0.12, -0.16, -0.21, -0.29, -0.08, 0.16],[0.14, 0.07, -0.02, 0.08, -0.14, 0.22, 0.46, -0.19, -0.48, 0.26, -0.08]]},
+ {"i": 29,"j": 111, "score": 0.98, "iC": "RHLFWY", "jC": "DERHVILY", "matrix": [[0.36, 0.43, 0.09, 0.06, -0.45, -0.28, -0.15, -0.22],[-0.13, 0.47, -0.28, -0.11, 0.38, 0.44, -0.38, -0.37],[-0.02, -0.07, 0.00, 0.17, 0.10, 0.04, -0.03, -0.21],[-0.09, -0.36, 0.13, -0.22, 0.04, 0.08, 0.30, 0.28],[-0.01, -0.05, -0.03, -0.02, -0.06, -0.07, -0.04, 0.21],[-0.06, -0.23, 0.08, 0.13, -0.26, -0.37, 0.38, 0.33]]},
+ {"i": 29,"j": 152, "score": 0.69, "iC": "RHNLFY", "jC": "HVIFY", "matrix": [[-0.10, -0.17, -0.30, -0.04, 0.66],[-0.13, 0.04, 0.38, 0.19, -0.12],[-0.03, -0.01, 0.26, -0.05, 0.02],[0.03, 0.22, -0.10, -0.23, -0.03],[0.24, -0.05, 0.09, -0.00, -0.35],[-0.03, -0.09, -0.28, 0.28, 0.10]]},
+ {"i": 29,"j": 154, "score": 0.97, "iC": "RHFWY", "jC": "DEKHQNTVIF", "matrix": [[0.64, -0.20, -0.12, -0.06, -0.11, 0.29, 0.40, -0.36, -0.15, -0.06],[-0.19, 0.40, -0.10, 0.09, -0.09, 0.00, 0.39, -0.30, -0.37, -0.03],[-0.21, -0.16, 0.24, 0.14, 0.15, -0.11, 0.00, -0.32, -0.11, 0.20],[-0.04, -0.06, 0.01, -0.02, 0.04, -0.04, -0.25, 0.15, 0.40, -0.01],[-0.18, -0.12, -0.02, -0.20, -0.06, -0.08, -0.27, 0.70, 0.16, -0.06]]},
+ {"i": 30,"j": 94, "score": 1.14, "iC": "VLMFY", "jC": "ILF", "matrix": [[-0.26, -0.04, 0.50],[-0.23, 0.36, 0.18],[-0.12, 0.01, 0.17],[0.75, -0.31, -0.78],[-0.18, 0.06, -0.06]]},
+ {"i": 31,"j": 27, "score": 0.41, "iC": "KRQSTAV", "jC": "SLMF", "matrix": [[-0.20, 0.33, -0.12, 0.24],[0.15, -0.23, 0.04, -0.17],[0.05, 0.14, -0.16, -0.00],[-0.01, 0.16, -0.07, -0.03],[-0.01, -0.12, 0.24, -0.07],[-0.01, -0.05, 0.15, -0.07],[-0.00, -0.22, 0.26, 0.04]]},
+ {"i": 31,"j": 35, "score": 0.84, "iC": "KRAV", "jC": "EKRGVILMW", "matrix": [[-0.13, -0.64, -0.59, -0.22, 0.16, 0.34, 0.55, 0.38, -0.08],[0.22, -0.17, 0.07, 0.27, -0.14, -0.25, -0.16, 0.04, 0.18],[-0.01, 0.29, 0.09, -0.02, -0.03, 0.05, -0.17, -0.14, -0.02],[-0.02, 0.18, 0.15, -0.01, 0.01, -0.01, -0.11, -0.04, -0.01]]},
+ {"i": 31,"j": 54, "score": 0.64, "iC": "KRQ", "jC": "DKRSP", "matrix": [[-0.32, -0.40, -0.15, 0.22, 0.45],[0.50, -0.23, -0.05, -0.15, 0.08],[-0.06, 0.26, 0.12, -0.00, -0.19]]},
+ {"i": 32,"j": 28, "score": 0.88, "iC": "DEKRNTA", "jC": "EKRQGA", "matrix": [[-0.12, 0.29, 0.16, 0.11, -0.03, -0.29],[-0.14, 0.36, 0.43, -0.17, -0.07, -0.34],[0.02, -0.45, -0.32, 0.15, -0.04, 0.51],[-0.05, -0.48, -0.39, 0.22, 0.16, 0.43],[0.22, -0.14, -0.02, 0.04, -0.00, -0.17],[0.13, 0.05, -0.07, -0.04, 0.02, -0.18],[0.01, 0.33, 0.02, -0.15, 0.01, -0.03]]},
+ {"i": 32,"j": 33, "score": 0.49, "iC": "DEKRNST", "jC": "EKRHQTAVILM", "matrix": [[0.01, 0.08, 0.01, -0.07, 0.10, 0.10, -0.04, -0.01, -0.06, -0.22, -0.02],[-0.17, 0.64, 0.23, 0.03, 0.14, 0.11, -0.16, -0.26, -0.07, -0.09, -0.13],[-0.03, -0.30, -0.05, 0.15, -0.12, 0.08, 0.03, 0.08, 0.19, -0.19, 0.23],[0.14, -0.25, -0.14, -0.05, -0.15, 0.08, -0.09, 0.08, 0.08, -0.04, 0.08],[0.09, -0.10, -0.02, 0.00, -0.02, 0.10, 0.06, -0.08, -0.15, 0.10, -0.07],[-0.07, -0.04, 0.05, -0.02, 0.01, -0.19, -0.01, 0.24, -0.00, 0.03, -0.05],[-0.05, -0.01, -0.03, 0.01, -0.02, -0.13, 0.07, -0.03, 0.06, 0.19, 0.01]]},
+ {"i": 33,"j": 4, "score": 0.63, "iC": "STVILM", "jC": "VILM", "matrix": [[-0.08, 0.15, -0.02, -0.01],[-0.20, 0.14, -0.08, 0.20],[0.42, -0.22, -0.14, -0.01],[0.47, -0.17, -0.25, -0.04],[0.25, -0.25, 0.26, -0.11],[-0.36, 0.08, 0.04, 0.04]]},
+ {"i": 33,"j": 29, "score": 1.55, "iC": "KRHQNTVILMC", "jC": "RHQNILFWY", "matrix": [[-0.27, -0.16, 0.00, -0.09, 0.00, 0.05, 0.26, 0.10, 0.14],[-0.08, -0.24, 0.12, 0.05, 0.17, -0.01, -0.08, -0.02, 0.07],[-0.13, -0.02, -0.01, -0.01, 0.01, 0.07, -0.14, 0.21, -0.02],[-0.12, -0.26, -0.03, -0.06, -0.02, -0.05, 0.36, 0.15, 0.08],[-0.06, -0.23, -0.01, -0.02, -0.01, 0.00, 0.10, 0.33, -0.14],[-0.48, 0.37, -0.11, -0.14, -0.08, -0.18, 0.77, -0.12, 0.22],[-0.18, 0.32, -0.04, 0.09, -0.01, -0.15, -0.09, -0.16, 0.46],[0.55, 0.11, -0.02, 0.08, -0.07, -0.00, -0.45, -0.21, -0.19],[0.98, 0.12, 0.19, 0.18, -0.01, 0.11, -0.87, -0.29, -0.48],[-0.00, -0.08, -0.04, -0.07, 0.03, -0.01, 0.02, -0.08, 0.26],[-0.02, -0.05, -0.01, 0.00, 0.03, -0.02, -0.01, 0.16, -0.08]]},
+ {"i": 33,"j": 32, "score": 0.49, "iC": "EKRHQTAVILM", "jC": "DEKRNST", "matrix": [[0.01, -0.17, -0.03, 0.14, 0.09, -0.07, -0.05],[0.08, 0.64, -0.30, -0.25, -0.10, -0.04, -0.01],[0.01, 0.23, -0.05, -0.14, -0.02, 0.05, -0.03],[-0.07, 0.03, 0.15, -0.05, 0.00, -0.02, 0.01],[0.10, 0.14, -0.12, -0.15, -0.02, 0.01, -0.02],[0.10, 0.11, 0.08, 0.08, 0.10, -0.19, -0.13],[-0.04, -0.16, 0.03, -0.09, 0.06, -0.01, 0.07],[-0.01, -0.26, 0.08, 0.08, -0.08, 0.24, -0.03],[-0.06, -0.07, 0.19, 0.08, -0.15, -0.00, 0.06],[-0.22, -0.09, -0.19, -0.04, 0.10, 0.03, 0.19],[-0.02, -0.13, 0.23, 0.08, -0.07, -0.05, 0.01]]},
+ {"i": 33,"j": 92, "score": 0.50, "iC": "EKHTVILMY", "jC": "AVFWY", "matrix": [[0.04, -0.00, -0.19, -0.15, 0.22],[-0.01, 0.01, 0.02, 0.04, -0.16],[-0.01, -0.03, -0.25, 0.10, 0.09],[-0.15, -0.17, 0.56, 0.01, 0.18],[-0.04, -0.04, 0.05, -0.23, -0.04],[0.02, -0.03, 0.22, -0.25, 0.04],[0.01, -0.14, 0.14, 0.19, 0.02],[0.19, 0.01, -0.10, 0.33, -0.27],[-0.02, 0.31, -0.15, -0.08, -0.04]]},
+ {"i": 33,"j": 111, "score": 0.86, "iC": "EKQTAVILMY", "jC": "DERHVILFY", "matrix": [[-0.02, -0.09, 0.05, 0.12, 0.02, 0.12, 0.03, -0.05, -0.41],[-0.02, 0.09, -0.05, -0.06, -0.12, -0.18, -0.08, 0.13, 0.20],[0.01, -0.14, 0.01, -0.01, 0.04, 0.13, 0.24, -0.06, -0.21],[-0.03, -0.42, -0.11, -0.01, 0.21, 0.35, 0.08, 0.03, 0.03],[0.02, -0.11, 0.03, -0.06, 0.01, 0.01, 0.20, -0.05, -0.03],[0.27, -0.09, 0.03, -0.09, -0.21, -0.02, 0.04, -0.03, 0.13],[-0.04, 0.16, 0.04, 0.08, -0.22, -0.08, -0.09, -0.06, 0.27],[-0.13, 0.54, -0.12, 0.16, -0.11, -0.38, -0.58, 0.23, 0.29],[-0.03, 0.16, -0.06, 0.05, 0.03, -0.13, -0.11, -0.02, 0.13],[-0.01, -0.02, 0.17, -0.02, 0.24, 0.07, -0.05, -0.03, -0.28]]},
+ {"i": 34,"j": 56, "score": 0.66, "iC": "TVI", "jC": "RC", "matrix": [[0.57, -0.16],[-0.26, 0.09],[-0.30, 0.11]]},
+ {"i": 35,"j": 31, "score": 0.84, "iC": "EKRGVILMW", "jC": "KRAV", "matrix": [[-0.13, 0.22, -0.01, -0.02],[-0.64, -0.17, 0.29, 0.18],[-0.59, 0.07, 0.09, 0.15],[-0.22, 0.27, -0.02, -0.01],[0.16, -0.14, -0.03, 0.01],[0.34, -0.25, 0.05, -0.01],[0.55, -0.16, -0.17, -0.11],[0.38, 0.04, -0.14, -0.04],[-0.08, 0.18, -0.02, -0.01]]},
+ {"i": 35,"j": 36, "score": 0.43, "iC": "KSTGLM", "jC": "ERHNSGA", "matrix": [[0.02, 0.19, -0.02, 0.03, -0.06, 0.00, -0.11],[0.19, -0.11, 0.08, -0.14, -0.10, 0.04, 0.07],[-0.07, -0.06, -0.21, -0.32, 0.01, 0.22, 0.13],[0.00, 0.01, -0.03, -0.04, 0.19, -0.41, 0.02],[0.03, -0.08, 0.28, 0.39, -0.12, -0.16, -0.18],[-0.08, 0.00, -0.10, -0.09, 0.08, 0.27, 0.00]]},
+ {"i": 35,"j": 55, "score": 1.95, "iC": "DEKRQNSTVILMWY", "jC": "DEKRQNG", "matrix": [[-0.05, -0.02, -0.03, -0.01, -0.02, 0.22, -0.09],[-0.06, 0.00, 0.03, 0.04, -0.05, 0.41, -0.32],[0.21, 0.24, -0.15, -0.09, 0.09, -0.28, -0.12],[0.12, 0.08, 0.06, -0.04, 0.02, -0.23, -0.03],[-0.14, -0.02, 0.07, -0.02, -0.01, 0.29, -0.11],[-0.06, -0.02, -0.07, -0.01, 0.01, 0.22, -0.05],[-0.08, -0.22, 0.21, 0.05, -0.07, 0.71, -0.59],[0.16, -0.17, -0.06, -0.03, -0.06, 0.73, -0.56],[0.25, 0.09, 0.05, 0.06, 0.02, -0.04, -0.43],[0.15, 0.26, 0.04, -0.00, 0.11, -0.36, -0.23],[-0.04, 0.01, 0.24, 0.16, 0.24, -0.73, 0.09],[-0.27, -0.18, -0.26, -0.03, -0.19, -0.62, 1.49],[-0.11, 0.04, -0.08, -0.03, -0.01, -0.16, 0.39],[-0.05, -0.03, -0.01, -0.01, -0.02, -0.06, 0.22]]},
+ {"i": 36,"j": 35, "score": 0.43, "iC": "ERHNSGA", "jC": "KSTGLM", "matrix": [[0.02, 0.19, -0.07, 0.00, 0.03, -0.08],[0.19, -0.11, -0.06, 0.01, -0.08, 0.00],[-0.02, 0.08, -0.21, -0.03, 0.28, -0.10],[0.03, -0.14, -0.32, -0.04, 0.39, -0.09],[-0.06, -0.10, 0.01, 0.19, -0.12, 0.08],[0.00, 0.04, 0.22, -0.41, -0.16, 0.27],[-0.11, 0.07, 0.13, 0.02, -0.18, 0.00]]},
+ {"i": 36,"j": 55, "score": 0.62, "iC": "DHNGA", "jC": "DKRQNG", "matrix": [[-0.20, 0.02, 0.45, -0.06, -0.17, -0.06],[0.09, -0.08, -0.09, 0.18, 0.01, -0.29],[-0.07, 0.15, -0.04, 0.17, 0.11, -0.32],[0.07, -0.02, -0.35, -0.22, 0.16, 0.46],[-0.09, 0.00, 0.01, -0.02, -0.10, 0.23]]},
+ {"i": 37,"j": 38, "score": 0.70, "iC": "EKHQNTPGCFY", "jC": "KHSTPAVIC", "matrix": [[-0.01, -0.01, -0.02, 0.00, -0.18, 0.07, 0.05, 0.07, -0.01],[0.22, -0.22, -0.09, 0.11, 0.19, -0.19, 0.05, -0.11, -0.10],[-0.00, 0.44, 0.19, -0.16, 0.21, -0.07, -0.24, -0.25, 0.15],[-0.01, -0.03, 0.02, 0.04, -0.33, -0.03, 0.15, 0.15, -0.02],[-0.06, -0.03, -0.04, 0.11, -0.24, 0.10, 0.02, 0.24, -0.04],[-0.01, 0.00, 0.01, -0.09, -0.18, 0.20, -0.00, -0.05, -0.01],[-0.00, -0.00, -0.01, -0.06, -0.06, -0.00, 0.16, -0.01, -0.00],[-0.02, -0.04, -0.01, 0.16, -0.66, 0.03, 0.20, 0.19, -0.00],[-0.01, -0.03, -0.02, -0.14, 0.25, -0.04, -0.11, -0.03, 0.02],[-0.00, -0.01, -0.01, -0.03, 0.21, -0.03, -0.04, -0.02, -0.01],[-0.01, -0.02, -0.03, -0.10, 0.40, -0.11, -0.07, -0.00, -0.01]]},
+ {"i": 37,"j": 89, "score": 0.56, "iC": "KRHQNTGAVMC", "jC": "DEKRTP", "matrix": [[0.31, 0.31, -0.31, -0.30, 0.01, 0.09],[0.17, -0.02, -0.08, -0.06, -0.03, 0.00],[0.25, 0.21, -0.28, -0.01, 0.16, -0.09],[-0.07, -0.17, 0.20, 0.09, -0.05, -0.06],[-0.18, -0.16, 0.29, 0.13, 0.01, -0.09],[-0.08, 0.41, -0.03, 0.04, -0.02, -0.04],[-0.06, -0.24, 0.04, 0.21, -0.03, -0.02],[0.21, -0.18, 0.02, -0.11, -0.07, 0.15],[-0.10, 0.29, -0.03, -0.02, -0.01, -0.02],[-0.04, -0.09, 0.20, -0.01, -0.02, -0.00],[-0.19, -0.15, 0.03, 0.12, 0.04, 0.14]]},
+ {"i": 37,"j": 90, "score": 0.93, "iC": "KRHNSTAVCY", "jC": "DEKRHQTAVL", "matrix": [[0.54, 0.98, -0.34, -0.38, -0.13, -0.18, -0.22, 0.11, -0.09, -0.11],[0.09, 0.21, -0.13, -0.14, 0.03, -0.04, -0.07, -0.01, -0.06, -0.00],[-0.06, 0.27, -0.07, -0.19, -0.16, 0.03, 0.10, -0.21, 0.17, 0.27],[-0.27, 0.01, 0.15, -0.07, 0.16, 0.00, 0.01, -0.07, -0.00, -0.07],[-0.02, -0.21, 0.02, 0.09, 0.01, 0.04, 0.03, -0.00, -0.06, -0.01],[0.08, -0.19, -0.02, 0.03, -0.02, -0.03, 0.03, -0.05, -0.02, -0.04],[0.05, -0.19, 0.01, 0.21, -0.01, 0.03, -0.13, -0.01, 0.09, -0.00],[-0.03, -0.06, 0.02, -0.06, -0.02, -0.04, 0.16, -0.01, -0.00, -0.01],[-0.03, -0.24, 0.15, 0.11, -0.03, -0.04, 0.05, 0.11, -0.02, -0.07],[-0.00, -0.13, 0.15, -0.04, -0.00, 0.08, -0.01, 0.02, 0.01, 0.02]]},
+ {"i": 37,"j": 92, "score": 1.40, "iC": "KRHQNSTGAVCY", "jC": "SAVIMCFWY", "matrix": [[-0.15, 0.41, 0.54, 0.33, 0.72, 0.31, -1.04, -0.60, -0.33],[-0.05, 0.08, 0.20, -0.03, 0.18, 0.08, -0.25, -0.09, -0.13],[-0.15, -0.29, -0.32, -0.28, -0.10, -0.06, 0.67, 0.01, 0.29],[-0.01, -0.04, -0.05, 0.16, -0.06, -0.02, -0.01, -0.08, 0.07],[-0.04, -0.02, -0.08, -0.01, -0.06, -0.02, 0.18, -0.13, 0.15],[0.11, -0.01, -0.02, -0.03, -0.16, -0.08, 0.03, 0.12, 0.01],[0.24, -0.06, -0.02, -0.03, -0.00, -0.05, -0.12, 0.00, 0.00],[-0.05, -0.09, -0.04, -0.05, -0.20, -0.11, 0.08, 0.18, 0.25],[0.19, -0.08, -0.06, -0.04, -0.10, -0.07, 0.14, 0.11, -0.03],[-0.01, -0.01, -0.01, -0.01, -0.02, -0.01, -0.06, 0.18, -0.08],[-0.04, -0.01, -0.04, 0.08, -0.11, -0.01, -0.02, 0.28, -0.11],[0.01, -0.02, -0.02, 0.00, -0.06, -0.02, 0.20, 0.01, -0.08]]},
+ {"i": 38,"j": 37, "score": 0.70, "iC": "KHSTPAVIC", "jC": "EKHQNTPGCFY", "matrix": [[-0.01, 0.22, -0.00, -0.01, -0.06, -0.01, -0.00, -0.02, -0.01, -0.00, -0.01],[-0.01, -0.22, 0.44, -0.03, -0.03, 0.00, -0.00, -0.04, -0.03, -0.01, -0.02],[-0.02, -0.09, 0.19, 0.02, -0.04, 0.01, -0.01, -0.01, -0.02, -0.01, -0.03],[0.00, 0.11, -0.16, 0.04, 0.11, -0.09, -0.06, 0.16, -0.14, -0.03, -0.10],[-0.18, 0.19, 0.21, -0.33, -0.24, -0.18, -0.06, -0.66, 0.25, 0.21, 0.40],[0.07, -0.19, -0.07, -0.03, 0.10, 0.20, -0.00, 0.03, -0.04, -0.03, -0.11],[0.05, 0.05, -0.24, 0.15, 0.02, -0.00, 0.16, 0.20, -0.11, -0.04, -0.07],[0.07, -0.11, -0.25, 0.15, 0.24, -0.05, -0.01, 0.19, -0.03, -0.02, -0.00],[-0.01, -0.10, 0.15, -0.02, -0.04, -0.01, -0.00, -0.00, 0.02, -0.01, -0.01]]},
+ {"i": 38,"j": 57, "score": 1.08, "iC": "KHSTPAVIY", "jC": "DEKRHNTPAVIL", "matrix": [[0.01, 0.36, -0.24, -0.12, -0.01, -0.01, 0.04, 0.03, -0.01, -0.04, -0.04, -0.03],[-0.04, -0.10, -0.10, -0.23, 0.00, -0.02, 0.27, -0.03, -0.03, 0.26, 0.10, -0.13],[-0.01, 0.05, 0.06, 0.19, 0.08, -0.02, -0.13, -0.04, 0.03, 0.00, -0.12, -0.06],[-0.00, -0.31, 0.58, 0.68, 0.33, 0.24, -0.36, -0.05, -0.06, -0.26, -0.26, -0.31],[0.19, -0.02, -0.14, -0.17, -0.10, -0.17, -0.04, 0.30, 0.19, -0.31, -0.18, 0.24],[-0.03, -0.15, 0.03, -0.03, -0.08, -0.08, -0.37, -0.06, -0.03, 0.06, -0.06, 0.52],[-0.16, 0.11, -0.11, -0.33, -0.11, -0.08, 0.19, -0.03, -0.01, 0.24, 0.41, -0.23],[0.02, 0.13, -0.09, -0.07, -0.06, -0.05, 0.02, -0.05, -0.00, -0.01, 0.29, -0.05],[-0.01, -0.06, 0.05, -0.08, -0.02, -0.01, 0.16, -0.00, -0.01, -0.02, -0.03, 0.03]]},
+ {"i": 38,"j": 58, "score": 0.41, "iC": "HTPAV", "jC": "HNT", "matrix": [[-0.01, -0.41, 0.16],[-0.13, -0.00, 0.19],[0.04, 0.48, -0.34],[-0.16, 0.24, -0.10],[0.05, -0.08, 0.19]]},
+ {"i": 38,"j": 59, "score": 0.58, "iC": "HSTPAVLM", "jC": "VILFWY", "matrix": [[0.21, -0.32, 0.08, -0.03, 0.00, -0.05],[-0.22, 0.19, -0.02, 0.01, -0.02, 0.13],[0.45, 0.07, -0.10, -0.21, 0.07, -0.28],[-0.34, 0.29, -0.04, 0.14, -0.16, 0.09],[-0.14, 0.17, -0.06, 0.01, -0.04, 0.13],[0.06, 0.09, -0.07, 0.01, 0.15, -0.10],[0.05, -0.13, 0.16, -0.00, -0.01, -0.03],[0.16, -0.13, -0.02, -0.01, -0.00, -0.01]]},
+ {"i": 38,"j": 85, "score": 0.39, "iC": "DTPAVLMC", "jC": "SAVILCY", "matrix": [[0.02, -0.16, -0.04, 0.03, 0.00, -0.05, 0.12],[0.02, -0.18, -0.21, -0.07, -0.18, 0.07, 0.15],[-0.12, -0.13, 0.31, -0.07, 0.16, -0.02, -0.17],[-0.18, 0.08, 0.16, -0.08, 0.44, -0.06, -0.06],[-0.03, -0.07, 0.00, 0.07, 0.10, -0.23, 0.01],[-0.01, -0.01, 0.02, 0.17, -0.12, -0.03, 0.02],[0.04, 0.16, -0.03, -0.03, -0.08, -0.02, -0.01],[-0.03, 0.28, -0.06, -0.02, -0.01, -0.04, -0.03]]},
+ {"i": 38,"j": 88, "score": 0.70, "iC": "HSTPAIL", "jC": "DERHSPAVILF", "matrix": [[0.26, 0.32, -0.03, -0.01, -0.11, -0.04, -0.07, -0.03, -0.04, 0.10, -0.02],[-0.06, 0.19, -0.00, -0.02, 0.10, -0.01, -0.10, -0.03, -0.04, -0.05, 0.06],[0.16, 0.01, -0.13, -0.04, 0.03, 0.11, -0.23, -0.23, -0.20, -0.06, -0.07],[-0.34, -0.40, -0.02, -0.15, 0.26, -0.05, 0.68, 0.36, -0.07, -0.18, 0.20],[-0.07, -0.00, 0.03, 0.16, -0.14, -0.17, -0.21, 0.01, 0.27, 0.36, -0.07],[0.11, 0.04, 0.01, 0.03, -0.15, 0.13, -0.02, -0.11, -0.08, -0.02, 0.03],[-0.01, -0.07, 0.15, -0.01, 0.01, 0.08, -0.06, 0.06, -0.00, -0.02, -0.01]]},
+ {"i": 38,"j": 89, "score": 0.38, "iC": "KHTPVI", "jC": "EKRSTPGA", "matrix": [[0.29, -0.14, -0.03, -0.05, -0.01, 0.02, -0.04, 0.07],[-0.05, -0.01, -0.10, 0.18, 0.11, -0.03, -0.07, -0.02],[0.24, -0.14, -0.15, 0.00, 0.08, -0.21, 0.35, -0.14],[0.08, -0.14, -0.13, 0.01, -0.19, 0.26, 0.14, 0.18],[-0.12, 0.18, 0.15, 0.01, -0.02, -0.02, -0.06, 0.02],[-0.26, 0.21, 0.19, 0.01, 0.00, -0.05, 0.07, -0.04]]},
+ {"i": 39,"j": 58, "score": 1.15, "iC": "VILM", "jC": "HNSTM", "matrix": [[-0.46, 0.84, -0.35, -0.22, -0.07],[0.08, 0.16, 0.03, -0.00, -0.04],[0.10, -0.50, 0.02, 0.10, 0.17],[0.41, -0.78, 0.40, 0.20, -0.04]]},
+ {"i": 39,"j": 94, "score": 0.90, "iC": "VILM", "jC": "STGAVILMCF", "matrix": [[-0.04, -0.03, -0.13, 0.06, -0.30, 0.35, 0.21, 0.42, -0.12, -0.34],[-0.05, 0.26, -0.07, -0.26, 0.05, 0.29, -0.12, -0.36, 0.18, 0.06],[0.17, -0.12, 0.33, 0.17, -0.06, -0.50, -0.16, 0.00, -0.14, 0.38],[-0.04, -0.08, -0.08, 0.16, 0.38, -0.05, -0.06, -0.10, -0.06, -0.08]]},
+ {"i": 40,"j": 59, "score": 0.38, "iC": "VIL", "jC": "VIL", "matrix": [[0.18, 0.12, -0.20],[-0.01, 0.31, -0.15],[-0.10, -0.32, 0.33]]},
+ {"i": 40,"j": 81, "score": 0.79, "iC": "AVIL", "jC": "SGAVLF", "matrix": [[-0.01, -0.02, -0.17, -0.04, 0.11, 0.07],[-0.14, -0.20, -0.46, 0.29, 0.33, 0.14],[0.23, -0.16, 0.39, -0.14, 0.01, -0.32],[-0.08, 0.38, 0.24, -0.12, -0.40, 0.06]]},
+ {"i": 40,"j": 91, "score": 1.09, "iC": "VIL", "jC": "TPAVILY", "matrix": [[0.33, -0.13, -0.35, 0.27, 0.24, 0.02, -0.21],[-0.22, 0.20, 0.53, -0.08, -0.31, -0.79, 0.26],[-0.09, -0.09, -0.20, -0.09, 0.04, 0.76, -0.07]]},
+ {"i": 40,"j": 103, "score": 0.40, "iC": "VIL", "jC": "STGVLF", "matrix": [[-0.04, -0.13, -0.19, 0.08, -0.05, 0.30],[0.16, -0.24, 0.18, 0.05, -0.19, 0.14],[-0.11, 0.32, 0.01, -0.17, 0.30, -0.34]]},
+ {"i": 41,"j": 49, "score": 0.57, "iC": "SVLM", "jC": "ILFY", "matrix": [[-0.06, -0.05, -0.08, 0.18],[-0.07, -0.11, 0.23, -0.01],[-0.02, -0.19, 0.10, -0.01],[0.26, 0.46, -0.47, -0.12]]},
+ {"i": 41,"j": 94, "score": 0.38, "iC": "MF", "jC": "SIC", "matrix": [[-0.15, 0.44, -0.28],[0.07, -0.18, 0.07]]},
+ {"i": 43,"j": 44, "score": 0.70, "iC": "KRY", "jC": "KN", "matrix": [[-0.27, 0.27],[0.63, -0.61],[-0.11, 0.17]]},
+ {"i": 43,"j": 47, "score": 1.06, "iC": "KRSY", "jC": "DEKRLF", "matrix": [[0.09, -0.17, -0.07, -0.05, 0.12, 0.16],[0.40, 0.97, -0.39, -0.34, -0.27, -0.11],[-0.12, -0.25, 0.03, 0.16, -0.01, 0.01],[-0.12, -0.27, 0.06, 0.02, 0.21, -0.03]]},
+ {"i": 44,"j": 17, "score": 0.47, "iC": "KNTGAVL", "jC": "KNG", "matrix": [[-0.16, 0.14, 0.09],[0.07, 0.35, -0.33],[0.08, -0.39, 0.14],[-0.01, -0.13, 0.16],[0.01, -0.21, 0.20],[0.01, -0.26, 0.11],[0.00, 0.19, -0.11]]},
+ {"i": 44,"j": 43, "score": 0.70, "iC": "KN", "jC": "KRY", "matrix": [[-0.27, 0.63, -0.11],[0.27, -0.61, 0.17]]},
+ {"i": 44,"j": 47, "score": 0.66, "iC": "KRNAL", "jC": "DEKQNVLF", "matrix": [[0.22, 0.13, -0.33, 0.20, -0.05, -0.02, -0.25, 0.16],[0.11, 0.34, -0.04, -0.02, -0.11, -0.15, -0.07, -0.12],[-0.36, -0.55, 0.27, -0.14, 0.16, 0.18, 0.29, 0.08],[0.19, -0.12, -0.04, -0.01, 0.00, -0.00, -0.05, -0.03],[-0.12, 0.15, 0.04, 0.04, 0.02, -0.02, 0.04, -0.06]]},
+ {"i": 44,"j": 98, "score": 0.52, "iC": "KRNVL", "jC": "DEKRQ", "matrix": [[0.25, 0.74, -0.24, -0.28, -0.12],[-0.02, 0.29, -0.10, 0.05, -0.25],[-0.07, -0.30, 0.05, 0.05, 0.13],[-0.01, -0.20, 0.08, -0.01, 0.07],[-0.05, -0.23, 0.09, 0.07, 0.08]]},
+ {"i": 45,"j": 48, "score": 0.56, "iC": "ST", "jC": "ESA", "matrix": [[0.13, -0.41, 0.33],[-0.17, 0.45, -0.28]]},
+ {"i": 46,"j": 49, "score": 0.47, "iC": "HLFWY", "jC": "VILMF", "matrix": [[0.03, 0.34, -0.25, -0.04, -0.06],[-0.05, -0.23, -0.13, 0.13, 0.34],[0.02, -0.11, -0.15, 0.20, 0.02],[-0.13, -0.13, 0.39, -0.15, -0.18],[0.17, 0.28, -0.12, -0.04, -0.17]]},
+ {"i": 46,"j": 50, "score": 0.36, "iC": "HLFW", "jC": "PG", "matrix": [[-0.22, 0.19],[0.16, -0.10],[-0.28, -0.01],[0.55, -0.20]]},
+ {"i": 46,"j": 52, "score": 0.54, "iC": "HFWY", "jC": "PV", "matrix": [[-0.52, 0.19],[-0.01, 0.16],[0.45, -0.17],[0.36, -0.23]]},
+ {"i": 46,"j": 58, "score": 0.36, "iC": "FY", "jC": "HNI", "matrix": [[0.46, -0.28, -0.09],[-0.44, -0.03, 0.16]]},
+ {"i": 46,"j": 69, "score": 0.45, "iC": "HLFWY", "jC": "HSAVILFY", "matrix": [[-0.01, 0.19, -0.11, -0.09, -0.05, 0.04, 0.01, -0.03],[-0.05, -0.00, -0.27, 0.14, 0.03, -0.00, 0.21, -0.02],[0.43, -0.02, -0.11, -0.20, -0.11, -0.28, -0.06, 0.10],[-0.17, 0.09, 0.40, -0.03, -0.07, 0.12, -0.21, -0.17],[-0.19, -0.19, 0.14, 0.18, 0.21, 0.15, -0.08, -0.02]]},
+ {"i": 46,"j": 72, "score": 0.63, "iC": "HFWY", "jC": "EAVC", "matrix": [[0.00, -0.27, -0.05, 0.38],[-0.13, -0.28, 0.25, -0.18],[0.00, 0.75, -0.24, -0.38],[0.16, -0.18, -0.03, 0.13]]},
+ {"i": 47,"j": 43, "score": 1.06, "iC": "DEKRLF", "jC": "KRSY", "matrix": [[0.09, 0.40, -0.12, -0.12],[-0.17, 0.97, -0.25, -0.27],[-0.07, -0.39, 0.03, 0.06],[-0.05, -0.34, 0.16, 0.02],[0.12, -0.27, -0.01, 0.21],[0.16, -0.11, 0.01, -0.03]]},
+ {"i": 47,"j": 44, "score": 0.66, "iC": "DEKQNVLF", "jC": "KRNAL", "matrix": [[0.22, 0.11, -0.36, 0.19, -0.12],[0.13, 0.34, -0.55, -0.12, 0.15],[-0.33, -0.04, 0.27, -0.04, 0.04],[0.20, -0.02, -0.14, -0.01, 0.04],[-0.05, -0.11, 0.16, 0.00, 0.02],[-0.02, -0.15, 0.18, -0.00, -0.02],[-0.25, -0.07, 0.29, -0.05, 0.04],[0.16, -0.12, 0.08, -0.03, -0.06]]},
+ {"i": 47,"j": 67, "score": 0.88, "iC": "DEQAL", "jC": "LFWY", "matrix": [[0.34, -0.25, 0.41, -0.45],[-0.26, -0.35, -0.08, 1.04],[-0.05, 0.32, -0.19, -0.20],[0.05, 0.18, -0.14, -0.03],[-0.15, 0.04, 0.11, -0.14]]},
+ {"i": 48,"j": 17, "score": 0.54, "iC": "DESTG", "jC": "NG", "matrix": [[-0.09, 0.15],[-0.13, 0.23],[0.66, -0.17],[-0.26, -0.05],[-0.17, 0.03]]},
+ {"i": 48,"j": 45, "score": 0.56, "iC": "ESA", "jC": "ST", "matrix": [[0.13, -0.17],[-0.41, 0.45],[0.33, -0.28]]},
+ {"i": 49,"j": 41, "score": 0.57, "iC": "ILFY", "jC": "SVLM", "matrix": [[-0.06, -0.07, -0.02, 0.26],[-0.05, -0.11, -0.19, 0.46],[-0.08, 0.23, 0.10, -0.47],[0.18, -0.01, -0.01, -0.12]]},
+ {"i": 49,"j": 46, "score": 0.47, "iC": "VILMF", "jC": "HLFWY", "matrix": [[0.03, -0.05, 0.02, -0.13, 0.17],[0.34, -0.23, -0.11, -0.13, 0.28],[-0.25, -0.13, -0.15, 0.39, -0.12],[-0.04, 0.13, 0.20, -0.15, -0.04],[-0.06, 0.34, 0.02, -0.18, -0.17]]},
+ {"i": 49,"j": 50, "score": 1.30, "iC": "ILMF", "jC": "DKNPGV", "matrix": [[-0.19, -0.34, -0.32, -0.46, 0.92, 0.26],[0.01, 0.19, -0.02, 0.61, -0.48, -0.22],[0.10, 0.03, 0.35, -0.48, 0.01, -0.05],[0.05, 0.15, -0.05, 0.60, -0.46, -0.07]]},
+ {"i": 49,"j": 51, "score": 0.40, "iC": "ILMF", "jC": "KRHQSG", "matrix": [[0.19, 0.40, 0.16, -0.06, -0.01, -0.40],[-0.07, -0.11, -0.06, 0.17, -0.18, 0.33],[-0.13, -0.03, -0.08, -0.09, -0.01, 0.18],[0.08, -0.16, -0.02, -0.01, 0.09, -0.11]]},
+ {"i": 49,"j": 52, "score": 0.49, "iC": "ILMF", "jC": "KPAVLM", "matrix": [[-0.08, 0.22, 0.14, -0.03, -0.17, -0.07],[0.21, -0.34, -0.16, 0.12, 0.06, 0.16],[-0.01, -0.28, 0.11, -0.02, 0.07, -0.03],[-0.05, 0.54, -0.09, -0.19, 0.02, -0.07]]},
+ {"i": 49,"j": 58, "score": 0.70, "iC": "ILMF", "jC": "HNSTY", "matrix": [[-0.56, 0.21, 0.25, 0.25, -0.10],[0.32, 0.12, -0.27, -0.27, -0.05],[-0.31, -0.20, 0.20, 0.03, 0.19],[0.47, -0.19, -0.16, -0.13, 0.01]]},
+ {"i": 49,"j": 94, "score": 0.38, "iC": "VILMF", "jC": "TVILM", "matrix": [[0.04, 0.18, -0.27, -0.05, -0.02],[0.01, -0.07, -0.06, -0.32, 0.03],[-0.01, -0.30, 0.17, 0.11, 0.23],[-0.01, 0.08, 0.20, 0.00, -0.08],[-0.15, 0.07, 0.27, 0.15, -0.23]]},
+ {"i": 50,"j": 46, "score": 0.36, "iC": "PG", "jC": "HLFW", "matrix": [[-0.22, 0.16, -0.28, 0.55],[0.19, -0.10, -0.01, -0.20]]},
+ {"i": 50,"j": 49, "score": 1.30, "iC": "DKNPGV", "jC": "ILMF", "matrix": [[-0.19, 0.01, 0.10, 0.05],[-0.34, 0.19, 0.03, 0.15],[-0.32, -0.02, 0.35, -0.05],[-0.46, 0.61, -0.48, 0.60],[0.92, -0.48, 0.01, -0.46],[0.26, -0.22, -0.05, -0.07]]},
+ {"i": 50,"j": 51, "score": 0.73, "iC": "DNPGAVL", "jC": "KRSG", "matrix": [[-0.16, -0.02, 0.00, 0.05],[-0.17, 0.02, -0.01, 0.09],[-0.31, 0.00, 0.10, 0.32],[0.29, 0.63, -0.16, -0.66],[-0.08, -0.17, 0.02, 0.15],[0.01, -0.18, 0.01, 0.06],[0.20, -0.22, -0.02, -0.02]]},
+ {"i": 50,"j": 58, "score": 0.44, "iC": "NPG", "jC": "HNST", "matrix": [[-0.10, 0.16, -0.06, 0.07],[0.46, -0.02, -0.17, -0.40],[-0.37, 0.05, 0.20, 0.18]]},
+ {"i": 51,"j": 49, "score": 0.40, "iC": "KRHQSG", "jC": "ILMF", "matrix": [[0.19, -0.07, -0.13, 0.08],[0.40, -0.11, -0.03, -0.16],[0.16, -0.06, -0.08, -0.02],[-0.06, 0.17, -0.09, -0.01],[-0.01, -0.18, -0.01, 0.09],[-0.40, 0.33, 0.18, -0.11]]},
+ {"i": 51,"j": 50, "score": 0.73, "iC": "KRSG", "jC": "DNPGAVL", "matrix": [[-0.16, -0.17, -0.31, 0.29, -0.08, 0.01, 0.20],[-0.02, 0.02, 0.00, 0.63, -0.17, -0.18, -0.22],[0.00, -0.01, 0.10, -0.16, 0.02, 0.01, -0.02],[0.05, 0.09, 0.32, -0.66, 0.15, 0.06, -0.02]]},
+ {"i": 51,"j": 52, "score": 0.64, "iC": "KRQGA", "jC": "PAVIL", "matrix": [[0.47, 0.08, -0.12, -0.17, -0.23],[0.21, -0.23, 0.26, -0.00, 0.09],[0.16, -0.01, -0.03, -0.03, -0.05],[-0.64, 0.26, -0.10, 0.13, 0.27],[0.16, -0.02, -0.03, -0.00, -0.06]]},
+ {"i": 52,"j": 46, "score": 0.54, "iC": "PV", "jC": "HFWY", "matrix": [[-0.52, -0.01, 0.45, 0.36],[0.19, 0.16, -0.17, -0.23]]},
+ {"i": 52,"j": 49, "score": 0.49, "iC": "KPAVLM", "jC": "ILMF", "matrix": [[-0.08, 0.21, -0.01, -0.05],[0.22, -0.34, -0.28, 0.54],[0.14, -0.16, 0.11, -0.09],[-0.03, 0.12, -0.02, -0.19],[-0.17, 0.06, 0.07, 0.02],[-0.07, 0.16, -0.03, -0.07]]},
+ {"i": 52,"j": 51, "score": 0.64, "iC": "PAVIL", "jC": "KRQGA", "matrix": [[0.47, 0.21, 0.16, -0.64, 0.16],[0.08, -0.23, -0.01, 0.26, -0.02],[-0.12, 0.26, -0.03, -0.10, -0.03],[-0.17, -0.00, -0.03, 0.13, -0.00],[-0.23, 0.09, -0.05, 0.27, -0.06]]},
+ {"i": 52,"j": 58, "score": 0.81, "iC": "KPAVILM", "jC": "HN", "matrix": [[0.11, -0.15],[-0.22, 0.65],[-0.39, 0.48],[0.09, -0.15],[0.07, -0.21],[0.40, -0.44],[0.18, -0.12]]},
+ {"i": 52,"j": 60, "score": 0.36, "iC": "AVL", "jC": "VI", "matrix": [[0.18, -0.26],[-0.17, 0.07],[-0.28, 0.30]]},
+ {"i": 53,"j": 56, "score": 0.58, "iC": "L", "jC": "KR", "matrix": [[-0.16, 0.59]]},
+ {"i": 54,"j": 31, "score": 0.64, "iC": "DKRSP", "jC": "KRQ", "matrix": [[-0.32, 0.50, -0.06],[-0.40, -0.23, 0.26],[-0.15, -0.05, 0.12],[0.22, -0.15, -0.00],[0.45, 0.08, -0.19]]},
+ {"i": 54,"j": 55, "score": 0.52, "iC": "KRPAV", "jC": "DKRNG", "matrix": [[0.41, -0.39, -0.17, 0.35, 0.02],[0.19, -0.05, -0.03, 0.05, -0.15],[-0.37, 0.14, 0.16, -0.03, 0.03],[-0.12, 0.05, -0.00, 0.00, 0.18],[0.16, -0.02, -0.02, -0.09, -0.12]]},
+ {"i": 55,"j": 35, "score": 1.95, "iC": "DEKRQNG", "jC": "DEKRQNSTVILMWY", "matrix": [[-0.05, -0.06, 0.21, 0.12, -0.14, -0.06, -0.08, 0.16, 0.25, 0.15, -0.04, -0.27, -0.11, -0.05],[-0.02, 0.00, 0.24, 0.08, -0.02, -0.02, -0.22, -0.17, 0.09, 0.26, 0.01, -0.18, 0.04, -0.03],[-0.03, 0.03, -0.15, 0.06, 0.07, -0.07, 0.21, -0.06, 0.05, 0.04, 0.24, -0.26, -0.08, -0.01],[-0.01, 0.04, -0.09, -0.04, -0.02, -0.01, 0.05, -0.03, 0.06, -0.00, 0.16, -0.03, -0.03, -0.01],[-0.02, -0.05, 0.09, 0.02, -0.01, 0.01, -0.07, -0.06, 0.02, 0.11, 0.24, -0.19, -0.01, -0.02],[0.22, 0.41, -0.28, -0.23, 0.29, 0.22, 0.71, 0.73, -0.04, -0.36, -0.73, -0.62, -0.16, -0.06],[-0.09, -0.32, -0.12, -0.03, -0.11, -0.05, -0.59, -0.56, -0.43, -0.23, 0.09, 1.49, 0.39, 0.22]]},
+ {"i": 55,"j": 36, "score": 0.62, "iC": "DKRQNG", "jC": "DHNGA", "matrix": [[-0.20, 0.09, -0.07, 0.07, -0.09],[0.02, -0.08, 0.15, -0.02, 0.00],[0.45, -0.09, -0.04, -0.35, 0.01],[-0.06, 0.18, 0.17, -0.22, -0.02],[-0.17, 0.01, 0.11, 0.16, -0.10],[-0.06, -0.29, -0.32, 0.46, 0.23]]},
+ {"i": 55,"j": 54, "score": 0.52, "iC": "DKRNG", "jC": "KRPAV", "matrix": [[0.41, 0.19, -0.37, -0.12, 0.16],[-0.39, -0.05, 0.14, 0.05, -0.02],[-0.17, -0.03, 0.16, -0.00, -0.02],[0.35, 0.05, -0.03, 0.00, -0.09],[0.02, -0.15, 0.03, 0.18, -0.12]]},
+ {"i": 56,"j": 34, "score": 0.66, "iC": "RC", "jC": "TVI", "matrix": [[0.57, -0.26, -0.30],[-0.16, 0.09, 0.11]]},
+ {"i": 56,"j": 53, "score": 0.58, "iC": "KR", "jC": "L", "matrix": [[-0.16],[0.59]]},
+ {"i": 57,"j": 38, "score": 1.08, "iC": "DEKRHNTPAVIL", "jC": "KHSTPAVIY", "matrix": [[0.01, -0.04, -0.01, -0.00, 0.19, -0.03, -0.16, 0.02, -0.01],[0.36, -0.10, 0.05, -0.31, -0.02, -0.15, 0.11, 0.13, -0.06],[-0.24, -0.10, 0.06, 0.58, -0.14, 0.03, -0.11, -0.09, 0.05],[-0.12, -0.23, 0.19, 0.68, -0.17, -0.03, -0.33, -0.07, -0.08],[-0.01, 0.00, 0.08, 0.33, -0.10, -0.08, -0.11, -0.06, -0.02],[-0.01, -0.02, -0.02, 0.24, -0.17, -0.08, -0.08, -0.05, -0.01],[0.04, 0.27, -0.13, -0.36, -0.04, -0.37, 0.19, 0.02, 0.16],[0.03, -0.03, -0.04, -0.05, 0.30, -0.06, -0.03, -0.05, -0.00],[-0.01, -0.03, 0.03, -0.06, 0.19, -0.03, -0.01, -0.00, -0.01],[-0.04, 0.26, 0.00, -0.26, -0.31, 0.06, 0.24, -0.01, -0.02],[-0.04, 0.10, -0.12, -0.26, -0.18, -0.06, 0.41, 0.29, -0.03],[-0.03, -0.13, -0.06, -0.31, 0.24, 0.52, -0.23, -0.05, 0.03]]},
+ {"i": 57,"j": 58, "score": 0.49, "iC": "EKHTPVIL", "jC": "HNST", "matrix": [[-0.01, -0.11, -0.12, 0.19],[-0.05, -0.16, -0.11, 0.10],[0.18, -0.26, 0.03, 0.02],[-0.22, -0.15, 0.40, 0.13],[0.37, -0.21, -0.13, -0.07],[-0.07, 0.18, 0.03, -0.12],[-0.11, 0.14, 0.16, -0.11],[0.02, 0.44, -0.09, -0.18]]},
+ {"i": 57,"j": 73, "score": 1.76, "iC": "DEKRHQTPAVILF", "jC": "DEKRHSTAVILFY", "matrix": [[-0.03, -0.15, -0.02, 0.14, -0.02, 0.14, 0.21, 0.00, -0.21, -0.00, 0.03, -0.03, 0.02],[-0.12, -0.37, 0.23, 0.47, 0.34, -0.03, 0.46, 0.01, -0.17, -0.22, -0.11, -0.07, -0.04],[0.06, 0.32, -0.10, -0.12, -0.01, 0.11, -0.11, 0.02, -0.04, -0.13, -0.08, 0.18, -0.03],[0.48, 1.19, -0.26, -0.54, -0.22, -0.22, -0.52, -0.11, -0.34, -0.30, -0.46, -0.11, -0.09],[0.08, 0.09, -0.13, -0.09, -0.08, 0.39, 0.53, -0.05, -0.12, -0.27, -0.22, 0.00, -0.06],[0.10, -0.05, -0.09, -0.02, -0.03, 0.04, 0.09, -0.05, -0.14, -0.04, 0.16, -0.01, -0.07],[-0.22, -0.20, -0.03, 0.11, -0.01, -0.19, -0.34, -0.15, 0.41, 0.65, 0.55, 0.02, 0.07],[-0.00, -0.08, -0.00, -0.13, 0.15, 0.03, 0.09, 0.08, -0.19, -0.05, -0.13, 0.03, 0.11],[-0.03, -0.08, -0.01, 0.16, 0.01, 0.03, -0.06, -0.01, -0.08, 0.09, -0.09, -0.00, 0.08],[-0.05, -0.06, 0.02, 0.01, 0.06, -0.09, -0.18, -0.03, 0.07, 0.18, 0.12, 0.01, 0.11],[-0.05, -0.19, 0.03, -0.00, 0.20, -0.13, -0.15, -0.04, -0.03, 0.09, 0.05, 0.20, 0.27],[-0.15, -0.27, 0.05, 0.03, -0.18, -0.06, -0.14, 0.08, 0.48, 0.12, 0.29, -0.09, -0.16],[-0.02, -0.06, 0.02, 0.01, -0.08, 0.01, -0.06, 0.13, 0.15, -0.01, 0.01, -0.00, -0.05]]},
+ {"i": 57,"j": 84, "score": 0.41, "iC": "ERHTPVIL", "jC": "EKRQSALMFY", "matrix": [[-0.08, -0.07, 0.11, -0.10, -0.01, -0.02, -0.03, -0.11, -0.05, 0.41],[-0.06, -0.15, -0.13, -0.01, 0.18, 0.14, 0.43, 0.23, -0.22, -0.30],[0.03, -0.06, -0.02, -0.07, 0.03, 0.18, 0.03, -0.07, -0.10, 0.02],[0.16, 0.16, 0.00, 0.18, -0.05, -0.13, -0.31, -0.20, 0.07, -0.05],[-0.01, 0.07, 0.18, 0.02, -0.04, 0.07, -0.23, -0.04, 0.01, -0.06],[-0.00, -0.18, -0.01, -0.04, -0.11, -0.01, -0.06, -0.08, 0.18, 0.06],[0.02, -0.03, -0.03, 0.04, 0.06, -0.16, -0.00, 0.01, 0.08, -0.10],[-0.04, -0.04, 0.16, 0.16, -0.23, -0.20, 0.05, -0.00, 0.06, 0.02]]},
+ {"i": 58,"j": 38, "score": 0.41, "iC": "HNT", "jC": "HTPAV", "matrix": [[-0.01, -0.13, 0.04, -0.16, 0.05],[-0.41, -0.00, 0.48, 0.24, -0.08],[0.16, 0.19, -0.34, -0.10, 0.19]]},
+ {"i": 58,"j": 39, "score": 1.15, "iC": "HNSTM", "jC": "VILM", "matrix": [[-0.46, 0.08, 0.10, 0.41],[0.84, 0.16, -0.50, -0.78],[-0.35, 0.03, 0.02, 0.40],[-0.22, -0.00, 0.10, 0.20],[-0.07, -0.04, 0.17, -0.04]]},
+ {"i": 58,"j": 46, "score": 0.36, "iC": "HNI", "jC": "FY", "matrix": [[0.46, -0.44],[-0.28, -0.03],[-0.09, 0.16]]},
+ {"i": 58,"j": 49, "score": 0.70, "iC": "HNSTY", "jC": "ILMF", "matrix": [[-0.56, 0.32, -0.31, 0.47],[0.21, 0.12, -0.20, -0.19],[0.25, -0.27, 0.20, -0.16],[0.25, -0.27, 0.03, -0.13],[-0.10, -0.05, 0.19, 0.01]]},
+ {"i": 58,"j": 50, "score": 0.44, "iC": "HNST", "jC": "NPG", "matrix": [[-0.10, 0.46, -0.37],[0.16, -0.02, 0.05],[-0.06, -0.17, 0.20],[0.07, -0.40, 0.18]]},
+ {"i": 58,"j": 52, "score": 0.81, "iC": "HN", "jC": "KPAVILM", "matrix": [[0.11, -0.22, -0.39, 0.09, 0.07, 0.40, 0.18],[-0.15, 0.65, 0.48, -0.15, -0.21, -0.44, -0.12]]},
+ {"i": 58,"j": 57, "score": 0.49, "iC": "HNST", "jC": "EKHTPVIL", "matrix": [[-0.01, -0.05, 0.18, -0.22, 0.37, -0.07, -0.11, 0.02],[-0.11, -0.16, -0.26, -0.15, -0.21, 0.18, 0.14, 0.44],[-0.12, -0.11, 0.03, 0.40, -0.13, 0.03, 0.16, -0.09],[0.19, 0.10, 0.02, 0.13, -0.07, -0.12, -0.11, -0.18]]},
+ {"i": 58,"j": 94, "score": 0.81, "iC": "HNSTVI", "jC": "AVIMC", "matrix": [[-0.07, 0.03, 0.27, -0.07, -0.07],[-0.55, -0.17, 0.46, 0.24, -0.19],[-0.13, 0.00, 0.31, -0.05, -0.07],[0.31, 0.31, -0.50, -0.11, 0.14],[0.22, -0.06, -0.20, -0.02, 0.11],[0.19, -0.07, -0.20, -0.02, 0.06]]},
+ {"i": 59,"j": 38, "score": 0.58, "iC": "VILFWY", "jC": "HSTPAVLM", "matrix": [[0.21, -0.22, 0.45, -0.34, -0.14, 0.06, 0.05, 0.16],[-0.32, 0.19, 0.07, 0.29, 0.17, 0.09, -0.13, -0.13],[0.08, -0.02, -0.10, -0.04, -0.06, -0.07, 0.16, -0.02],[-0.03, 0.01, -0.21, 0.14, 0.01, 0.01, -0.00, -0.01],[0.00, -0.02, 0.07, -0.16, -0.04, 0.15, -0.01, -0.00],[-0.05, 0.13, -0.28, 0.09, 0.13, -0.10, -0.03, -0.01]]},
+ {"i": 59,"j": 40, "score": 0.38, "iC": "VIL", "jC": "VIL", "matrix": [[0.18, -0.01, -0.10],[0.12, 0.31, -0.32],[-0.20, -0.15, 0.33]]},
+ {"i": 59,"j": 75, "score": 0.90, "iC": "AVILFWY", "jC": "HTAVIMF", "matrix": [[-0.02, -0.02, -0.05, -0.11, -0.03, -0.01, 0.20],[-0.09, -0.12, 0.47, -0.01, -0.00, -0.11, -0.32],[-0.12, 0.24, 0.43, 0.39, -0.23, 0.16, -0.60],[0.25, -0.07, -0.43, -0.07, 0.03, -0.05, 0.42],[0.03, -0.01, -0.17, 0.12, 0.09, 0.09, 0.02],[-0.01, -0.02, 0.00, -0.13, -0.04, -0.01, 0.22],[-0.03, -0.00, -0.15, 0.02, 0.28, -0.03, -0.00]]},
+ {"i": 59,"j": 84, "score": 0.40, "iC": "VILFW", "jC": "KRHNSTALMWY", "matrix": [[-0.05, -0.00, -0.16, -0.07, 0.06, 0.15, -0.21, 0.17, -0.08, 0.23, 0.03],[-0.03, -0.06, 0.00, -0.16, -0.19, -0.01, -0.17, 0.27, 0.20, -0.15, 0.23],[-0.08, 0.17, 0.06, -0.06, 0.04, -0.05, 0.01, -0.31, 0.04, 0.12, 0.14],[0.20, -0.03, 0.08, -0.04, 0.01, -0.06, 0.00, 0.01, -0.05, -0.04, -0.09],[-0.01, -0.03, -0.02, 0.02, 0.00, -0.02, 0.29, -0.08, -0.02, -0.03, -0.05]]},
+ {"i": 59,"j": 85, "score": 0.55, "iC": "AVILF", "jC": "GALCF", "matrix": [[-0.01, -0.06, 0.20, -0.04, -0.02],[-0.23, -0.58, 0.30, -0.16, 0.32],[0.21, 0.37, -0.26, 0.03, -0.13],[0.03, 0.08, -0.10, 0.17, -0.11],[-0.05, 0.23, -0.09, -0.04, 0.05]]},
+ {"i": 60,"j": 52, "score": 0.36, "iC": "VI", "jC": "AVL", "matrix": [[0.18, -0.17, -0.28],[-0.26, 0.07, 0.30]]},
+ {"i": 60,"j": 69, "score": 0.41, "iC": "VI", "jC": "DQVLF", "matrix": [[-0.15, -0.23, -0.30, 0.25, 0.14],[0.21, 0.24, 0.30, -0.24, -0.16]]},
+ {"i": 61,"j": 81, "score": 0.36, "iC": "VIL", "jC": "GAVIF", "matrix": [[0.31, 0.09, -0.12, -0.12, -0.12],[-0.04, 0.27, -0.16, -0.11, 0.11],[-0.18, -0.21, 0.19, 0.22, -0.15]]},
+ {"i": 61,"j": 99, "score": 0.95, "iC": "VILM", "jC": "VILM", "matrix": [[-0.76, -0.00, 0.46, 0.30],[0.04, 0.26, -0.17, -0.17],[0.68, -0.38, -0.22, -0.13],[0.16, -0.02, -0.12, 0.04]]},
+ {"i": 61,"j": 102, "score": 0.38, "iC": "VILMF", "jC": "HQSALMY", "matrix": [[0.06, 0.18, 0.16, 0.17, -0.38, -0.20, -0.00],[0.03, 0.06, 0.09, 0.08, -0.29, 0.02, 0.11],[-0.19, 0.02, -0.21, -0.15, 0.25, 0.15, -0.16],[0.07, -0.14, 0.02, -0.01, 0.17, 0.02, 0.01],[0.01, -0.10, -0.01, -0.05, 0.19, -0.01, 0.02]]},
+ {"i": 61,"j": 103, "score": 0.69, "iC": "VILM", "jC": "STGAVLFY", "matrix": [[0.16, 0.17, 0.29, 0.10, -0.01, -0.05, -0.58, -0.12],[0.10, 0.07, -0.07, 0.12, 0.16, -0.19, -0.30, -0.11],[-0.23, -0.22, -0.20, -0.18, -0.06, 0.16, 0.57, 0.26],[-0.09, -0.02, -0.02, -0.14, -0.04, 0.08, 0.28, -0.03]]},
+ {"i": 62,"j": 64, "score": 0.48, "iC": "ST", "jC": "DEQST", "matrix": [[-0.22, 0.09, -0.11, 0.20, 0.51],[0.15, -0.16, 0.18, -0.05, -0.38]]},
+ {"i": 62,"j": 65, "score": 0.42, "iC": "ST", "jC": "KRNTLMFY", "matrix": [[-0.17, -0.20, -0.10, -0.16, 0.36, 0.24, 0.17, 0.14],[0.16, 0.20, 0.19, 0.17, -0.34, -0.22, -0.17, -0.15]]},
+ {"i": 62,"j": 67, "score": 0.49, "iC": "ST", "jC": "QLFWY", "matrix": [[0.17, 0.19, -0.10, -0.51, -0.25],[-0.12, -0.22, 0.16, 0.42, 0.16]]},
+ {"i": 62,"j": 74, "score": 0.68, "iC": "ST", "jC": "HPAILW", "matrix": [[0.30, -0.15, -0.23, -0.27, 0.37, 0.31],[-0.28, 0.07, 0.23, 0.35, -0.48, -0.30]]},
+ {"i": 62,"j": 76, "score": 0.60, "iC": "ST", "jC": "KRHNY", "matrix": [[0.11, 0.27, -0.40, -0.18, -0.24],[-0.15, -0.38, 0.51, 0.27, 0.25]]},
+ {"i": 63,"j": 64, "score": 0.47, "iC": "KRHST", "jC": "DKRHQNST", "matrix": [[-0.10, 0.01, -0.12, -0.01, -0.17, 0.13, 0.06, 0.20],[0.41, -0.18, -0.22, -0.09, 0.05, 0.11, 0.25, -0.17],[0.10, -0.03, 0.08, 0.16, 0.13, -0.06, -0.10, -0.18],[-0.19, 0.17, 0.34, 0.04, 0.01, -0.15, -0.22, -0.02],[-0.10, -0.01, 0.11, 0.00, 0.01, -0.14, -0.07, 0.21]]},
+ {"i": 63,"j": 98, "score": 1.14, "iC": "RHSTG", "jC": "DEKRQSTGAM", "matrix": [[0.47, 1.07, -0.38, -0.64, 0.33, -0.30, -0.28, -0.21, 0.04, -0.27],[-0.10, -0.09, -0.02, -0.03, 0.08, 0.02, -0.03, -0.02, 0.15, -0.07],[-0.17, -0.27, 0.26, 0.31, -0.11, -0.05, 0.02, 0.19, -0.11, -0.05],[0.02, -0.21, 0.16, 0.15, -0.25, -0.08, 0.11, -0.03, 0.03, 0.02],[-0.03, -0.20, 0.07, 0.14, -0.05, 0.15, -0.01, -0.00, -0.01, 0.01]]},
+ {"i": 64,"j": 62, "score": 0.48, "iC": "DEQST", "jC": "ST", "matrix": [[-0.22, 0.15],[0.09, -0.16],[-0.11, 0.18],[0.20, -0.05],[0.51, -0.38]]},
+ {"i": 64,"j": 63, "score": 0.47, "iC": "DKRHQNST", "jC": "KRHST", "matrix": [[-0.10, 0.41, 0.10, -0.19, -0.10],[0.01, -0.18, -0.03, 0.17, -0.01],[-0.12, -0.22, 0.08, 0.34, 0.11],[-0.01, -0.09, 0.16, 0.04, 0.00],[-0.17, 0.05, 0.13, 0.01, 0.01],[0.13, 0.11, -0.06, -0.15, -0.14],[0.06, 0.25, -0.10, -0.22, -0.07],[0.20, -0.17, -0.18, -0.02, 0.21]]},
+ {"i": 64,"j": 65, "score": 1.00, "iC": "DEKRHQNSTG", "jC": "DEKRQNSTPGAVLMF", "matrix": [[-0.22, 0.11, 0.11, 0.27, -0.01, -0.19, -0.09, 0.04, 0.26, -0.25, 0.18, 0.02, -0.03, -0.00, -0.09],[-0.07, 0.01, 0.18, 0.03, -0.05, 0.00, -0.08, 0.05, 0.03, -0.02, -0.08, -0.04, 0.06, 0.02, -0.02],[0.13, 0.21, -0.07, -0.05, -0.11, 0.06, 0.05, -0.00, -0.22, 0.15, -0.14, -0.03, -0.09, 0.07, -0.02],[0.20, 0.20, -0.08, -0.12, -0.09, 0.02, 0.07, 0.10, 0.07, -0.09, -0.02, -0.03, -0.15, -0.08, -0.05],[0.04, -0.03, -0.07, 0.00, -0.02, -0.02, -0.04, 0.02, 0.19, -0.01, -0.02, 0.00, -0.03, -0.01, 0.01],[0.10, 0.15, 0.04, -0.32, 0.20, 0.17, 0.26, -0.06, -0.25, -0.16, 0.23, -0.04, -0.10, -0.14, -0.09],[-0.22, -0.25, 0.16, 0.39, -0.03, -0.19, 0.01, 0.13, 0.51, -0.10, 0.07, -0.12, -0.05, -0.17, -0.07],[0.04, -0.19, -0.18, -0.06, 0.02, 0.20, -0.11, -0.17, -0.43, 0.46, -0.21, 0.19, 0.21, 0.00, 0.25],[-0.14, -0.07, -0.05, -0.04, 0.09, -0.11, -0.16, -0.14, -0.08, -0.18, -0.10, 0.08, 0.43, 0.32, 0.05],[0.23, -0.05, -0.04, -0.05, -0.01, 0.03, 0.08, 0.01, -0.20, 0.22, -0.04, -0.04, -0.08, -0.04, -0.01]]},
+ {"i": 64,"j": 66, "score": 1.31, "iC": "DKRQNSTG", "jC": "DEKQNSTPGAILF", "matrix": [[-0.76, -0.19, 0.10, 0.05, 0.49, 0.59, 0.44, -0.22, -0.21, 0.40, -0.21, -0.19, 0.02],[0.20, -0.08, -0.14, -0.01, 0.02, -0.15, 0.00, -0.02, 0.04, -0.08, 0.11, 0.02, 0.01],[0.17, 0.01, -0.16, -0.06, -0.11, -0.18, -0.16, 0.22, 0.13, -0.12, 0.08, 0.11, -0.03],[0.60, -0.24, -0.16, -0.18, 0.08, -0.32, -0.24, -0.09, 0.41, -0.30, 0.19, 0.29, -0.10],[0.20, 0.39, 0.02, 0.06, 0.16, 0.16, -0.19, -0.20, -0.36, 0.37, -0.06, -0.12, -0.05],[-0.12, -0.01, -0.01, 0.10, -0.28, 0.05, 0.13, 0.13, -0.31, 0.02, -0.06, -0.04, 0.17],[-0.13, -0.07, 0.11, 0.15, -0.11, 0.02, 0.24, 0.11, 0.08, -0.16, -0.09, -0.06, -0.04],[-0.17, 0.01, 0.01, -0.06, -0.07, 0.01, -0.04, 0.10, -0.04, 0.01, -0.01, -0.01, 0.03]]},
+ {"i": 64,"j": 67, "score": 0.88, "iC": "DKRQNSTG", "jC": "DEKRNSGAILFWY", "matrix": [[-0.28, -0.28, -0.02, 0.26, -0.16, -0.12, -0.06, -0.22, -0.15, 0.15, 0.62, 0.23, 0.55],[0.07, 0.10, 0.02, -0.02, -0.05, -0.07, 0.03, -0.04, 0.07, 0.02, -0.17, 0.05, -0.00],[0.06, 0.00, -0.00, -0.09, -0.03, 0.10, 0.17, 0.04, 0.12, -0.07, -0.20, -0.08, -0.07],[-0.00, -0.04, -0.11, -0.16, 0.04, -0.02, -0.07, 0.05, -0.07, 0.16, -0.10, 0.12, 0.13],[-0.12, -0.24, -0.09, -0.06, -0.00, -0.16, -0.12, -0.05, 0.02, 0.24, 0.41, 0.27, 0.37],[0.06, 0.12, 0.19, -0.04, 0.13, 0.11, 0.05, 0.01, -0.03, -0.21, 0.04, -0.22, -0.44],[0.06, 0.13, 0.15, 0.03, 0.02, 0.10, -0.08, 0.09, 0.01, -0.26, -0.13, -0.15, -0.21],[0.07, 0.06, -0.04, 0.06, 0.05, -0.05, 0.01, 0.01, 0.07, -0.04, -0.13, -0.07, -0.15]]},
+ {"i": 65,"j": 62, "score": 0.42, "iC": "KRNTLMFY", "jC": "ST", "matrix": [[-0.17, 0.16],[-0.20, 0.20],[-0.10, 0.19],[-0.16, 0.17],[0.36, -0.34],[0.24, -0.22],[0.17, -0.17],[0.14, -0.15]]},
+ {"i": 65,"j": 64, "score": 1.00, "iC": "DEKRQNSTPGAVLMF", "jC": "DEKRHQNSTG", "matrix": [[-0.22, -0.07, 0.13, 0.20, 0.04, 0.10, -0.22, 0.04, -0.14, 0.23],[0.11, 0.01, 0.21, 0.20, -0.03, 0.15, -0.25, -0.19, -0.07, -0.05],[0.11, 0.18, -0.07, -0.08, -0.07, 0.04, 0.16, -0.18, -0.05, -0.04],[0.27, 0.03, -0.05, -0.12, 0.00, -0.32, 0.39, -0.06, -0.04, -0.05],[-0.01, -0.05, -0.11, -0.09, -0.02, 0.20, -0.03, 0.02, 0.09, -0.01],[-0.19, 0.00, 0.06, 0.02, -0.02, 0.17, -0.19, 0.20, -0.11, 0.03],[-0.09, -0.08, 0.05, 0.07, -0.04, 0.26, 0.01, -0.11, -0.16, 0.08],[0.04, 0.05, -0.00, 0.10, 0.02, -0.06, 0.13, -0.17, -0.14, 0.01],[0.26, 0.03, -0.22, 0.07, 0.19, -0.25, 0.51, -0.43, -0.08, -0.20],[-0.25, -0.02, 0.15, -0.09, -0.01, -0.16, -0.10, 0.46, -0.18, 0.22],[0.18, -0.08, -0.14, -0.02, -0.02, 0.23, 0.07, -0.21, -0.10, -0.04],[0.02, -0.04, -0.03, -0.03, 0.00, -0.04, -0.12, 0.19, 0.08, -0.04],[-0.03, 0.06, -0.09, -0.15, -0.03, -0.10, -0.05, 0.21, 0.43, -0.08],[-0.00, 0.02, 0.07, -0.08, -0.01, -0.14, -0.17, 0.00, 0.32, -0.04],[-0.09, -0.02, -0.02, -0.05, 0.01, -0.09, -0.07, 0.25, 0.05, -0.01]]},
+ {"i": 65,"j": 66, "score": 0.70, "iC": "DEKRNTPGAL", "jC": "DEKRNSTPGAVILM", "matrix": [[-0.26, -0.07, 0.02, 0.02, -0.16, -0.04, -0.07, 0.09, -0.04, -0.02, 0.03, 0.20, 0.19, -0.04],[-0.45, -0.17, 0.05, 0.16, 0.15, 0.09, -0.06, -0.08, 0.09, -0.09, -0.02, 0.14, 0.05, 0.16],[0.23, 0.08, 0.11, 0.04, 0.27, -0.18, -0.02, -0.01, -0.10, -0.07, -0.01, -0.08, -0.03, -0.04],[0.14, 0.23, -0.12, -0.06, 0.05, 0.02, 0.07, -0.02, -0.14, -0.03, -0.02, -0.05, -0.07, 0.08],[-0.11, -0.07, -0.07, 0.09, 0.10, -0.12, -0.07, 0.17, -0.10, 0.11, 0.01, 0.16, -0.02, 0.02],[0.17, -0.00, -0.12, -0.12, -0.13, 0.14, 0.15, 0.09, 0.06, 0.05, -0.04, -0.06, -0.02, -0.04],[0.09, 0.36, -0.19, -0.01, 0.01, -0.22, -0.26, -0.27, 0.17, 0.21, -0.03, -0.10, 0.13, 0.04],[-0.22, -0.06, -0.07, 0.05, -0.08, 0.11, -0.11, -0.10, -0.09, 0.00, 0.18, 0.06, 0.10, -0.03],[0.25, -0.02, 0.01, -0.04, -0.05, -0.09, -0.06, -0.02, 0.16, 0.21, -0.01, -0.01, -0.07, -0.07],[0.14, -0.06, 0.16, -0.04, -0.02, 0.04, 0.10, 0.12, -0.15, -0.13, 0.07, -0.07, -0.17, 0.04]]},
+ {"i": 65,"j": 67, "score": 0.43, "iC": "DEKRNSTPGL", "jC": "EKSVLFWY", "matrix": [[0.02, 0.17, 0.01, 0.02, -0.05, -0.05, -0.13, -0.09],[-0.13, -0.09, -0.02, -0.04, 0.09, 0.02, 0.14, 0.20],[-0.12, -0.13, -0.18, 0.01, 0.27, 0.34, 0.01, 0.13],[-0.07, 0.06, -0.12, -0.04, 0.09, 0.18, 0.10, 0.11],[-0.01, -0.04, 0.01, 0.08, 0.01, -0.06, -0.09, -0.17],[-0.09, -0.07, 0.02, 0.03, 0.16, 0.00, 0.06, 0.06],[-0.12, -0.03, -0.19, -0.05, 0.15, 0.05, 0.16, 0.01],[-0.08, 0.07, 0.01, -0.17, -0.17, 0.25, 0.11, 0.02],[0.05, 0.06, 0.07, 0.27, -0.03, -0.13, -0.14, -0.15],[0.25, 0.16, 0.11, -0.08, -0.25, -0.18, -0.09, -0.12]]},
+ {"i": 65,"j": 76, "score": 0.64, "iC": "DEKRQTPGALM", "jC": "DKRHNSTPGAY", "matrix": [[-0.04, 0.17, 0.12, 0.08, -0.02, -0.12, 0.07, -0.08, -0.01, -0.03, -0.01],[-0.16, 0.09, 0.24, 0.12, 0.09, -0.09, 0.10, -0.07, -0.02, -0.09, -0.04],[0.12, -0.13, -0.22, -0.11, 0.05, 0.00, -0.15, -0.04, -0.04, -0.10, 0.25],[-0.10, -0.08, -0.24, 0.23, -0.11, -0.02, -0.15, 0.09, 0.07, -0.02, 0.17],[-0.04, 0.03, -0.09, 0.17, 0.10, -0.04, -0.03, -0.04, -0.13, 0.11, 0.02],[-0.16, 0.02, -0.17, 0.30, -0.06, 0.19, -0.01, -0.14, 0.02, -0.05, -0.01],[0.08, -0.07, 0.04, -0.32, -0.18, 0.08, 0.19, 0.11, 0.14, -0.03, -0.09],[0.07, -0.02, -0.03, -0.38, -0.10, 0.03, 0.17, -0.03, 0.11, 0.11, -0.02],[0.09, -0.08, -0.03, -0.33, 0.04, -0.08, 0.28, 0.09, -0.00, 0.19, -0.12],[0.06, 0.02, 0.14, 0.21, -0.10, -0.07, -0.16, 0.19, -0.17, -0.00, -0.04],[0.06, -0.07, 0.41, 0.11, 0.05, -0.06, -0.14, -0.06, -0.05, -0.07, -0.03]]},
+ {"i": 66,"j": 64, "score": 1.31, "iC": "DEKQNSTPGAILF", "jC": "DKRQNSTG", "matrix": [[-0.76, 0.20, 0.17, 0.60, 0.20, -0.12, -0.13, -0.17],[-0.19, -0.08, 0.01, -0.24, 0.39, -0.01, -0.07, 0.01],[0.10, -0.14, -0.16, -0.16, 0.02, -0.01, 0.11, 0.01],[0.05, -0.01, -0.06, -0.18, 0.06, 0.10, 0.15, -0.06],[0.49, 0.02, -0.11, 0.08, 0.16, -0.28, -0.11, -0.07],[0.59, -0.15, -0.18, -0.32, 0.16, 0.05, 0.02, 0.01],[0.44, 0.00, -0.16, -0.24, -0.19, 0.13, 0.24, -0.04],[-0.22, -0.02, 0.22, -0.09, -0.20, 0.13, 0.11, 0.10],[-0.21, 0.04, 0.13, 0.41, -0.36, -0.31, 0.08, -0.04],[0.40, -0.08, -0.12, -0.30, 0.37, 0.02, -0.16, 0.01],[-0.21, 0.11, 0.08, 0.19, -0.06, -0.06, -0.09, -0.01],[-0.19, 0.02, 0.11, 0.29, -0.12, -0.04, -0.06, -0.01],[0.02, 0.01, -0.03, -0.10, -0.05, 0.17, -0.04, 0.03]]},
+ {"i": 66,"j": 65, "score": 0.70, "iC": "DEKRNSTPGAVILM", "jC": "DEKRNTPGAL", "matrix": [[-0.26, -0.45, 0.23, 0.14, -0.11, 0.17, 0.09, -0.22, 0.25, 0.14],[-0.07, -0.17, 0.08, 0.23, -0.07, -0.00, 0.36, -0.06, -0.02, -0.06],[0.02, 0.05, 0.11, -0.12, -0.07, -0.12, -0.19, -0.07, 0.01, 0.16],[0.02, 0.16, 0.04, -0.06, 0.09, -0.12, -0.01, 0.05, -0.04, -0.04],[-0.16, 0.15, 0.27, 0.05, 0.10, -0.13, 0.01, -0.08, -0.05, -0.02],[-0.04, 0.09, -0.18, 0.02, -0.12, 0.14, -0.22, 0.11, -0.09, 0.04],[-0.07, -0.06, -0.02, 0.07, -0.07, 0.15, -0.26, -0.11, -0.06, 0.10],[0.09, -0.08, -0.01, -0.02, 0.17, 0.09, -0.27, -0.10, -0.02, 0.12],[-0.04, 0.09, -0.10, -0.14, -0.10, 0.06, 0.17, -0.09, 0.16, -0.15],[-0.02, -0.09, -0.07, -0.03, 0.11, 0.05, 0.21, 0.00, 0.21, -0.13],[0.03, -0.02, -0.01, -0.02, 0.01, -0.04, -0.03, 0.18, -0.01, 0.07],[0.20, 0.14, -0.08, -0.05, 0.16, -0.06, -0.10, 0.06, -0.01, -0.07],[0.19, 0.05, -0.03, -0.07, -0.02, -0.02, 0.13, 0.10, -0.07, -0.17],[-0.04, 0.16, -0.04, 0.08, 0.02, -0.04, 0.04, -0.03, -0.07, 0.04]]},
+ {"i": 66,"j": 67, "score": 0.85, "iC": "DEKRNSPGVIL", "jC": "DEKNSGVLFWY", "matrix": [[-0.12, -0.35, -0.04, -0.10, -0.16, -0.09, -0.05, 0.22, 0.39, 0.28, 0.61],[-0.20, -0.22, 0.19, -0.02, -0.01, -0.03, 0.01, 0.17, -0.12, 0.03, 0.02],[0.14, 0.18, -0.05, 0.07, -0.03, -0.06, 0.00, -0.10, -0.21, -0.02, 0.01],[0.00, 0.13, -0.01, -0.02, 0.10, 0.00, 0.08, -0.11, -0.12, -0.03, -0.23],[-0.07, -0.15, -0.07, -0.06, -0.12, -0.00, -0.06, 0.10, 0.15, 0.16, 0.48],[-0.12, -0.09, -0.07, -0.06, 0.02, -0.07, 0.17, 0.32, 0.16, -0.11, -0.02],[0.12, 0.18, -0.05, -0.02, 0.05, 0.18, -0.05, -0.14, -0.15, -0.13, -0.20],[-0.04, -0.13, -0.01, -0.07, -0.09, 0.01, -0.05, 0.13, 0.28, 0.02, 0.19],[0.08, 0.01, 0.01, 0.05, -0.01, 0.04, -0.03, 0.02, -0.14, -0.06, -0.16],[0.15, 0.09, 0.13, 0.01, 0.13, 0.03, -0.04, -0.13, -0.17, -0.12, -0.24],[0.17, 0.12, 0.01, 0.17, 0.03, -0.03, -0.02, -0.13, -0.11, -0.15, -0.29]]},
+ {"i": 66,"j": 68, "score": 0.40, "iC": "DEKRHNSPGAL", "jC": "DEKRHQTPAVLY", "matrix": [[-0.12, -0.11, 0.23, 0.22, 0.02, 0.07, -0.19, -0.08, 0.14, 0.13, -0.10, 0.01],[0.00, -0.26, 0.15, 0.02, -0.07, -0.16, 0.13, 0.13, 0.01, 0.18, 0.01, 0.23],[-0.03, 0.20, 0.05, -0.08, -0.07, -0.08, -0.00, 0.10, 0.01, -0.01, -0.04, -0.01],[0.16, 0.14, -0.09, -0.05, -0.05, -0.11, -0.07, 0.11, 0.06, -0.04, -0.11, 0.07],[-0.03, -0.01, -0.13, 0.03, 0.03, 0.21, -0.01, -0.03, -0.01, -0.01, -0.06, -0.03],[-0.05, -0.14, 0.18, 0.02, 0.20, 0.09, 0.04, -0.05, -0.04, -0.06, -0.02, -0.07],[0.03, -0.02, -0.17, -0.00, 0.01, -0.02, 0.01, 0.03, 0.20, 0.01, -0.00, -0.06],[0.04, 0.01, -0.06, 0.00, 0.03, 0.00, 0.01, -0.08, -0.07, -0.07, 0.22, -0.03],[-0.10, 0.11, -0.03, -0.05, 0.00, -0.02, -0.01, -0.15, -0.00, 0.28, -0.14, -0.08],[0.09, 0.10, 0.12, -0.02, -0.06, 0.00, 0.16, -0.08, -0.02, -0.11, -0.14, -0.04],[-0.06, -0.08, -0.08, -0.11, -0.01, -0.01, -0.03, 0.03, -0.09, -0.03, 0.36, 0.03]]},
+ {"i": 67,"j": 47, "score": 0.88, "iC": "LFWY", "jC": "DEQAL", "matrix": [[0.34, -0.26, -0.05, 0.05, -0.15],[-0.25, -0.35, 0.32, 0.18, 0.04],[0.41, -0.08, -0.19, -0.14, 0.11],[-0.45, 1.04, -0.20, -0.03, -0.14]]},
+ {"i": 67,"j": 62, "score": 0.49, "iC": "QLFWY", "jC": "ST", "matrix": [[0.17, -0.12],[0.19, -0.22],[-0.10, 0.16],[-0.51, 0.42],[-0.25, 0.16]]},
+ {"i": 67,"j": 64, "score": 0.88, "iC": "DEKRNSGAILFWY", "jC": "DKRQNSTG", "matrix": [[-0.28, 0.07, 0.06, -0.00, -0.12, 0.06, 0.06, 0.07],[-0.28, 0.10, 0.00, -0.04, -0.24, 0.12, 0.13, 0.06],[-0.02, 0.02, -0.00, -0.11, -0.09, 0.19, 0.15, -0.04],[0.26, -0.02, -0.09, -0.16, -0.06, -0.04, 0.03, 0.06],[-0.16, -0.05, -0.03, 0.04, -0.00, 0.13, 0.02, 0.05],[-0.12, -0.07, 0.10, -0.02, -0.16, 0.11, 0.10, -0.05],[-0.06, 0.03, 0.17, -0.07, -0.12, 0.05, -0.08, 0.01],[-0.22, -0.04, 0.04, 0.05, -0.05, 0.01, 0.09, 0.01],[-0.15, 0.07, 0.12, -0.07, 0.02, -0.03, 0.01, 0.07],[0.15, 0.02, -0.07, 0.16, 0.24, -0.21, -0.26, -0.04],[0.62, -0.17, -0.20, -0.10, 0.41, 0.04, -0.13, -0.13],[0.23, 0.05, -0.08, 0.12, 0.27, -0.22, -0.15, -0.07],[0.55, -0.00, -0.07, 0.13, 0.37, -0.44, -0.21, -0.15]]},
+ {"i": 67,"j": 65, "score": 0.43, "iC": "EKSVLFWY", "jC": "DEKRNSTPGL", "matrix": [[0.02, -0.13, -0.12, -0.07, -0.01, -0.09, -0.12, -0.08, 0.05, 0.25],[0.17, -0.09, -0.13, 0.06, -0.04, -0.07, -0.03, 0.07, 0.06, 0.16],[0.01, -0.02, -0.18, -0.12, 0.01, 0.02, -0.19, 0.01, 0.07, 0.11],[0.02, -0.04, 0.01, -0.04, 0.08, 0.03, -0.05, -0.17, 0.27, -0.08],[-0.05, 0.09, 0.27, 0.09, 0.01, 0.16, 0.15, -0.17, -0.03, -0.25],[-0.05, 0.02, 0.34, 0.18, -0.06, 0.00, 0.05, 0.25, -0.13, -0.18],[-0.13, 0.14, 0.01, 0.10, -0.09, 0.06, 0.16, 0.11, -0.14, -0.09],[-0.09, 0.20, 0.13, 0.11, -0.17, 0.06, 0.01, 0.02, -0.15, -0.12]]},
+ {"i": 67,"j": 66, "score": 0.85, "iC": "DEKNSGVLFWY", "jC": "DEKRNSPGVIL", "matrix": [[-0.12, -0.20, 0.14, 0.00, -0.07, -0.12, 0.12, -0.04, 0.08, 0.15, 0.17],[-0.35, -0.22, 0.18, 0.13, -0.15, -0.09, 0.18, -0.13, 0.01, 0.09, 0.12],[-0.04, 0.19, -0.05, -0.01, -0.07, -0.07, -0.05, -0.01, 0.01, 0.13, 0.01],[-0.10, -0.02, 0.07, -0.02, -0.06, -0.06, -0.02, -0.07, 0.05, 0.01, 0.17],[-0.16, -0.01, -0.03, 0.10, -0.12, 0.02, 0.05, -0.09, -0.01, 0.13, 0.03],[-0.09, -0.03, -0.06, 0.00, -0.00, -0.07, 0.18, 0.01, 0.04, 0.03, -0.03],[-0.05, 0.01, 0.00, 0.08, -0.06, 0.17, -0.05, -0.05, -0.03, -0.04, -0.02],[0.22, 0.17, -0.10, -0.11, 0.10, 0.32, -0.14, 0.13, 0.02, -0.13, -0.13],[0.39, -0.12, -0.21, -0.12, 0.15, 0.16, -0.15, 0.28, -0.14, -0.17, -0.11],[0.28, 0.03, -0.02, -0.03, 0.16, -0.11, -0.13, 0.02, -0.06, -0.12, -0.15],[0.61, 0.02, 0.01, -0.23, 0.48, -0.02, -0.20, 0.19, -0.16, -0.24, -0.29]]},
+ {"i": 67,"j": 68, "score": 0.74, "iC": "DEKSVILFWY", "jC": "DEKRQNSPAVLFY", "matrix": [[-0.00, -0.19, -0.01, -0.09, -0.08, -0.11, 0.02, 0.03, -0.07, 0.05, 0.24, 0.24, 0.05],[-0.12, -0.18, 0.02, -0.07, -0.09, 0.07, -0.05, 0.05, 0.08, -0.02, 0.10, 0.00, 0.00],[0.02, 0.10, -0.12, -0.04, -0.04, -0.09, -0.05, -0.10, 0.03, 0.02, 0.09, 0.05, 0.15],[0.07, -0.11, -0.14, -0.12, -0.11, 0.04, -0.05, -0.02, -0.09, 0.19, 0.11, 0.08, -0.03],[0.04, 0.09, -0.08, -0.04, 0.02, -0.04, -0.06, 0.15, -0.03, -0.02, -0.03, 0.04, -0.02],[0.07, 0.23, -0.00, -0.04, -0.10, 0.05, 0.00, -0.03, -0.03, -0.06, -0.04, -0.05, -0.00],[0.06, 0.10, 0.27, 0.01, 0.05, -0.09, 0.02, -0.01, -0.08, 0.12, -0.19, -0.08, -0.06],[0.08, 0.12, 0.26, -0.05, -0.03, 0.16, 0.06, -0.11, 0.19, -0.07, -0.37, -0.18, -0.02],[-0.17, -0.25, -0.02, 0.15, 0.47, 0.12, 0.54, -0.17, -0.16, -0.33, -0.19, 0.03, 0.01],[0.09, 0.12, 0.20, 0.31, 0.34, -0.17, -0.20, -0.09, 0.11, -0.10, -0.22, -0.15, -0.19]]},
+ {"i": 67,"j": 69, "score": 1.52, "iC": "DEQSGALFWY", "jC": "DEHPGAVILFWY", "matrix": [[0.02, -0.06, 0.01, 0.08, 0.09, -0.17, 0.02, -0.09, -0.01, 0.05, -0.00, -0.05],[0.07, 0.02, -0.05, 0.24, -0.10, -0.24, -0.12, 0.06, -0.09, 0.02, -0.03, 0.03],[0.16, -0.02, -0.03, 0.01, -0.06, 0.06, -0.04, -0.06, -0.06, -0.00, -0.01, -0.01],[-0.03, 0.08, -0.03, 0.07, -0.03, -0.21, -0.03, 0.04, -0.04, 0.11, -0.00, 0.01],[-0.05, -0.02, -0.01, 0.00, -0.00, -0.12, -0.01, -0.03, -0.03, 0.00, 0.21, 0.08],[-0.01, 0.11, 0.03, -0.15, 0.00, -0.08, -0.11, -0.03, 0.06, 0.17, -0.00, 0.07],[-0.18, -0.01, -0.19, -0.46, -0.05, -0.60, 0.03, 0.94, 0.83, 0.07, 0.01, -0.04],[-0.02, -0.14, -0.01, 0.29, 0.03, 0.75, 0.08, -0.44, -0.16, -0.26, -0.07, -0.12],[0.02, 0.07, 0.42, -0.24, 0.16, 0.49, -0.14, -0.26, -0.34, -0.10, -0.04, 0.05],[-0.07, -0.20, -0.09, 0.33, 0.02, 0.74, 0.42, -0.35, 0.02, -0.34, -0.09, -0.27]]},
+ {"i": 67,"j": 72, "score": 0.47, "iC": "SPGLFWY", "jC": "NGAVIC", "matrix": [[-0.07, 0.01, -0.19, -0.07, -0.03, -0.02],[0.28, -0.04, -0.03, -0.04, -0.02, -0.03],[-0.06, 0.25, -0.07, -0.00, -0.01, -0.04],[0.08, -0.01, 0.14, -0.07, -0.07, 0.19],[-0.01, -0.22, -0.05, 0.20, 0.02, 0.20],[-0.12, -0.17, 0.16, 0.48, -0.02, -0.34],[-0.11, -0.16, 0.49, -0.20, 0.21, 0.11]]},
+ {"i": 67,"j": 74, "score": 0.49, "iC": "EKPLFWY", "jC": "RAVILMCFW", "matrix": [[-0.07, -0.03, -0.21, -0.02, 0.10, 0.01, 0.00, 0.15, 0.05],[-0.04, 0.07, -0.07, 0.03, -0.01, 0.02, -0.01, 0.16, 0.00],[0.03, -0.07, -0.18, 0.05, 0.09, -0.03, -0.04, 0.04, 0.18],[0.07, -0.18, 0.11, 0.00, -0.04, 0.17, 0.16, -0.04, -0.19],[0.00, 0.02, 0.36, 0.28, -0.12, -0.07, -0.10, -0.18, -0.17],[0.25, 0.26, 0.02, -0.23, -0.27, -0.11, -0.02, -0.08, -0.11],[-0.03, -0.19, 0.38, 0.31, 0.26, -0.01, -0.06, -0.05, -0.20]]},
+ {"i": 68,"j": 66, "score": 0.40, "iC": "DEKRHQTPAVLY", "jC": "DEKRHNSPGAL", "matrix": [[-0.12, 0.00, -0.03, 0.16, -0.03, -0.05, 0.03, 0.04, -0.10, 0.09, -0.06],[-0.11, -0.26, 0.20, 0.14, -0.01, -0.14, -0.02, 0.01, 0.11, 0.10, -0.08],[0.23, 0.15, 0.05, -0.09, -0.13, 0.18, -0.17, -0.06, -0.03, 0.12, -0.08],[0.22, 0.02, -0.08, -0.05, 0.03, 0.02, -0.00, 0.00, -0.05, -0.02, -0.11],[0.02, -0.07, -0.07, -0.05, 0.03, 0.20, 0.01, 0.03, 0.00, -0.06, -0.01],[0.07, -0.16, -0.08, -0.11, 0.21, 0.09, -0.02, 0.00, -0.02, 0.00, -0.01],[-0.19, 0.13, -0.00, -0.07, -0.01, 0.04, 0.01, 0.01, -0.01, 0.16, -0.03],[-0.08, 0.13, 0.10, 0.11, -0.03, -0.05, 0.03, -0.08, -0.15, -0.08, 0.03],[0.14, 0.01, 0.01, 0.06, -0.01, -0.04, 0.20, -0.07, -0.00, -0.02, -0.09],[0.13, 0.18, -0.01, -0.04, -0.01, -0.06, 0.01, -0.07, 0.28, -0.11, -0.03],[-0.10, 0.01, -0.04, -0.11, -0.06, -0.02, -0.00, 0.22, -0.14, -0.14, 0.36],[0.01, 0.23, -0.01, 0.07, -0.03, -0.07, -0.06, -0.03, -0.08, -0.04, 0.03]]},
+ {"i": 68,"j": 67, "score": 0.74, "iC": "DEKRQNSPAVLFY", "jC": "DEKSVILFWY", "matrix": [[-0.00, -0.12, 0.02, 0.07, 0.04, 0.07, 0.06, 0.08, -0.17, 0.09],[-0.19, -0.18, 0.10, -0.11, 0.09, 0.23, 0.10, 0.12, -0.25, 0.12],[-0.01, 0.02, -0.12, -0.14, -0.08, -0.00, 0.27, 0.26, -0.02, 0.20],[-0.09, -0.07, -0.04, -0.12, -0.04, -0.04, 0.01, -0.05, 0.15, 0.31],[-0.08, -0.09, -0.04, -0.11, 0.02, -0.10, 0.05, -0.03, 0.47, 0.34],[-0.11, 0.07, -0.09, 0.04, -0.04, 0.05, -0.09, 0.16, 0.12, -0.17],[0.02, -0.05, -0.05, -0.05, -0.06, 0.00, 0.02, 0.06, 0.54, -0.20],[0.03, 0.05, -0.10, -0.02, 0.15, -0.03, -0.01, -0.11, -0.17, -0.09],[-0.07, 0.08, 0.03, -0.09, -0.03, -0.03, -0.08, 0.19, -0.16, 0.11],[0.05, -0.02, 0.02, 0.19, -0.02, -0.06, 0.12, -0.07, -0.33, -0.10],[0.24, 0.10, 0.09, 0.11, -0.03, -0.04, -0.19, -0.37, -0.19, -0.22],[0.24, 0.00, 0.05, 0.08, 0.04, -0.05, -0.08, -0.18, 0.03, -0.15],[0.05, 0.00, 0.15, -0.03, -0.02, -0.00, -0.06, -0.02, 0.01, -0.19]]},
+ {"i": 68,"j": 69, "score": 0.48, "iC": "DEKHQNSTPALF", "jC": "ERPGAVILFY", "matrix": [[-0.15, -0.04, -0.16, 0.16, 0.02, -0.08, -0.02, 0.04, -0.00, 0.04],[-0.20, -0.04, -0.28, 0.07, 0.10, 0.11, 0.15, 0.09, 0.07, -0.10],[0.05, -0.09, -0.00, -0.12, 0.10, 0.24, 0.18, -0.03, -0.13, -0.12],[0.04, 0.11, 0.23, -0.01, -0.07, -0.12, -0.01, 0.01, -0.07, 0.01],[-0.08, -0.07, -0.06, 0.01, 0.33, 0.17, -0.17, 0.17, 0.03, 0.00],[0.02, 0.01, 0.18, -0.03, -0.16, -0.17, 0.06, -0.02, 0.09, 0.12],[-0.12, 0.22, -0.23, -0.07, 0.11, -0.05, -0.00, 0.01, 0.06, 0.03],[-0.03, -0.03, -0.23, -0.01, 0.15, 0.04, -0.06, 0.01, 0.02, 0.17],[-0.07, -0.02, -0.08, 0.00, -0.09, 0.10, -0.03, -0.06, 0.17, 0.13],[0.06, 0.01, 0.31, -0.04, -0.09, 0.06, -0.05, -0.01, -0.05, 0.04],[0.11, 0.02, 0.13, 0.08, -0.21, -0.19, -0.03, -0.09, -0.16, -0.10],[0.20, -0.06, 0.08, -0.04, -0.07, -0.12, -0.03, -0.08, -0.06, -0.04]]},
+ {"i": 68,"j": 70, "score": 0.60, "iC": "DEKRHNSTAVILF", "jC": "DEKPGA", "matrix": [[-0.26, -0.36, 0.01, 0.26, 0.16, -0.00],[-0.25, -0.19, 0.07, 0.27, -0.04, 0.09],[0.26, 0.14, 0.01, -0.26, -0.06, -0.01],[0.19, 0.40, 0.01, -0.19, -0.07, -0.20],[0.29, -0.03, 0.04, -0.17, -0.08, 0.06],[-0.08, -0.19, -0.00, 0.20, 0.04, -0.03],[-0.09, -0.05, -0.17, 0.35, -0.12, 0.04],[-0.04, -0.01, 0.07, 0.12, -0.17, -0.03],[-0.05, 0.36, 0.09, 0.09, -0.09, 0.16],[0.06, 0.17, 0.04, 0.05, 0.06, -0.13],[-0.05, 0.00, -0.04, -0.13, 0.19, -0.15],[-0.02, -0.11, 0.06, -0.14, 0.19, -0.01],[-0.04, -0.06, 0.11, -0.13, 0.23, -0.02]]},
+ {"i": 69,"j": 46, "score": 0.45, "iC": "HSAVILFY", "jC": "HLFWY", "matrix": [[-0.01, -0.05, 0.43, -0.17, -0.19],[0.19, -0.00, -0.02, 0.09, -0.19],[-0.11, -0.27, -0.11, 0.40, 0.14],[-0.09, 0.14, -0.20, -0.03, 0.18],[-0.05, 0.03, -0.11, -0.07, 0.21],[0.04, -0.00, -0.28, 0.12, 0.15],[0.01, 0.21, -0.06, -0.21, -0.08],[-0.03, -0.02, 0.10, -0.17, -0.02]]},
+ {"i": 69,"j": 60, "score": 0.41, "iC": "DQVLF", "jC": "VI", "matrix": [[-0.15, 0.21],[-0.23, 0.24],[-0.30, 0.30],[0.25, -0.24],[0.14, -0.16]]},
+ {"i": 69,"j": 67, "score": 1.52, "iC": "DEHPGAVILFWY", "jC": "DEQSGALFWY", "matrix": [[0.02, 0.07, 0.16, -0.03, -0.05, -0.01, -0.18, -0.02, 0.02, -0.07],[-0.06, 0.02, -0.02, 0.08, -0.02, 0.11, -0.01, -0.14, 0.07, -0.20],[0.01, -0.05, -0.03, -0.03, -0.01, 0.03, -0.19, -0.01, 0.42, -0.09],[0.08, 0.24, 0.01, 0.07, 0.00, -0.15, -0.46, 0.29, -0.24, 0.33],[0.09, -0.10, -0.06, -0.03, -0.00, 0.00, -0.05, 0.03, 0.16, 0.02],[-0.17, -0.24, 0.06, -0.21, -0.12, -0.08, -0.60, 0.75, 0.49, 0.74],[0.02, -0.12, -0.04, -0.03, -0.01, -0.11, 0.03, 0.08, -0.14, 0.42],[-0.09, 0.06, -0.06, 0.04, -0.03, -0.03, 0.94, -0.44, -0.26, -0.35],[-0.01, -0.09, -0.06, -0.04, -0.03, 0.06, 0.83, -0.16, -0.34, 0.02],[0.05, 0.02, -0.00, 0.11, 0.00, 0.17, 0.07, -0.26, -0.10, -0.34],[-0.00, -0.03, -0.01, -0.00, 0.21, -0.00, 0.01, -0.07, -0.04, -0.09],[-0.05, 0.03, -0.01, 0.01, 0.08, 0.07, -0.04, -0.12, 0.05, -0.27]]},
+ {"i": 69,"j": 68, "score": 0.48, "iC": "ERPGAVILFY", "jC": "DEKHQNSTPALF", "matrix": [[-0.15, -0.20, 0.05, 0.04, -0.08, 0.02, -0.12, -0.03, -0.07, 0.06, 0.11, 0.20],[-0.04, -0.04, -0.09, 0.11, -0.07, 0.01, 0.22, -0.03, -0.02, 0.01, 0.02, -0.06],[-0.16, -0.28, -0.00, 0.23, -0.06, 0.18, -0.23, -0.23, -0.08, 0.31, 0.13, 0.08],[0.16, 0.07, -0.12, -0.01, 0.01, -0.03, -0.07, -0.01, 0.00, -0.04, 0.08, -0.04],[0.02, 0.10, 0.10, -0.07, 0.33, -0.16, 0.11, 0.15, -0.09, -0.09, -0.21, -0.07],[-0.08, 0.11, 0.24, -0.12, 0.17, -0.17, -0.05, 0.04, 0.10, 0.06, -0.19, -0.12],[-0.02, 0.15, 0.18, -0.01, -0.17, 0.06, -0.00, -0.06, -0.03, -0.05, -0.03, -0.03],[0.04, 0.09, -0.03, 0.01, 0.17, -0.02, 0.01, 0.01, -0.06, -0.01, -0.09, -0.08],[-0.00, 0.07, -0.13, -0.07, 0.03, 0.09, 0.06, 0.02, 0.17, -0.05, -0.16, -0.06],[0.04, -0.10, -0.12, 0.01, 0.00, 0.12, 0.03, 0.17, 0.13, 0.04, -0.10, -0.04]]},
+ {"i": 69,"j": 70, "score": 1.00, "iC": "DEKRNSTPGAVILMFWY", "jC": "DEKRHQNSTPGY", "matrix": [[0.02, -0.36, -0.04, -0.04, 0.14, 0.03, 0.21, 0.05, 0.08, -0.40, 0.12, -0.09],[-0.16, -0.19, -0.03, 0.16, 0.10, -0.04, 0.20, -0.04, 0.17, -0.48, 0.13, 0.03],[0.05, 0.09, -0.03, 0.04, 0.00, 0.01, -0.01, 0.06, 0.03, -0.23, -0.06, 0.05],[0.00, 0.28, -0.02, -0.01, 0.02, -0.01, 0.01, -0.06, 0.02, -0.16, 0.06, 0.05],[0.04, -0.03, 0.02, -0.04, 0.01, 0.01, 0.05, 0.10, 0.07, -0.20, -0.11, 0.07],[-0.05, -0.06, -0.04, 0.00, -0.01, 0.01, -0.02, 0.07, 0.10, -0.28, -0.03, 0.15],[-0.11, -0.17, 0.02, 0.06, -0.05, -0.04, 0.02, 0.07, 0.05, -0.01, 0.09, -0.00],[-0.05, 0.03, 0.03, -0.00, -0.02, 0.20, -0.05, -0.09, -0.14, -0.59, 0.29, 0.03],[0.09, -0.04, 0.06, 0.02, 0.04, 0.09, -0.03, -0.01, -0.01, -0.32, -0.14, 0.04],[0.10, 0.22, -0.04, -0.08, -0.15, 0.11, -0.14, -0.06, -0.11, 0.33, 0.03, -0.09],[0.07, -0.00, 0.15, 0.04, 0.01, -0.05, -0.09, -0.13, -0.15, 0.56, -0.09, -0.04],[0.05, 0.08, 0.03, -0.03, -0.01, -0.03, -0.03, -0.08, -0.01, 0.21, -0.11, -0.02],[0.01, -0.12, -0.06, -0.06, -0.01, -0.08, -0.10, 0.08, -0.01, 0.65, 0.14, -0.05],[-0.07, -0.05, -0.02, -0.01, -0.01, 0.01, -0.02, 0.01, -0.01, 0.16, -0.03, -0.01],[0.07, 0.06, 0.04, -0.03, -0.04, -0.05, -0.02, 0.02, -0.07, 0.24, -0.00, -0.05],[-0.07, -0.04, -0.02, -0.01, -0.01, -0.02, 0.01, 0.24, -0.02, 0.02, -0.03, -0.01],[-0.00, 0.08, -0.06, -0.01, -0.02, -0.06, -0.06, -0.04, -0.05, 0.39, -0.01, -0.04]]},
+ {"i": 69,"j": 71, "score": 0.64, "iC": "DENSTPGAVILCFY", "jC": "DEKSPGA", "matrix": [[-0.11, -0.11, 0.06, -0.00, 0.27, -0.47, 0.03],[-0.03, 0.02, -0.09, 0.12, 0.03, -0.22, 0.16],[0.11, 0.03, 0.08, 0.04, 0.07, -0.31, -0.02],[0.06, 0.03, 0.03, 0.05, 0.08, -0.27, -0.04],[-0.10, 0.01, -0.01, 0.16, 0.09, -0.14, 0.03],[-0.24, -0.14, -0.18, -0.08, 0.08, 0.21, 0.12],[0.08, 0.14, -0.02, -0.06, -0.00, -0.16, -0.04],[-0.11, -0.06, -0.00, 0.03, -0.07, 0.52, -0.08],[0.04, 0.29, 0.01, 0.03, -0.08, 0.09, -0.11],[-0.04, -0.11, 0.08, -0.03, -0.15, 0.32, -0.10],[0.24, 0.01, 0.07, -0.05, -0.14, -0.27, 0.12],[-0.03, -0.05, -0.02, -0.02, -0.02, 0.26, -0.03],[-0.02, 0.02, -0.01, -0.03, -0.07, 0.26, -0.01],[-0.06, -0.06, -0.02, 0.01, -0.07, 0.21, -0.08]]},
+ {"i": 69,"j": 72, "score": 0.61, "iC": "DERHNTPAVILF", "jC": "DERQNPGAVIC", "matrix": [[0.04, -0.09, 0.19, 0.20, 0.09, -0.06, -0.09, -0.15, -0.11, -0.05, -0.17],[0.06, 0.07, 0.08, 0.00, -0.03, 0.09, 0.06, -0.20, -0.15, -0.03, -0.12],[0.09, -0.06, 0.01, -0.00, 0.07, 0.05, -0.09, -0.17, 0.02, 0.04, -0.04],[0.02, -0.02, 0.00, 0.07, -0.07, -0.02, -0.17, -0.11, 0.27, -0.05, -0.11],[0.08, 0.06, 0.02, 0.02, 0.10, 0.02, -0.16, -0.16, -0.05, 0.01, -0.02],[-0.05, -0.03, -0.01, 0.00, 0.28, -0.03, 0.05, 0.00, 0.00, -0.03, -0.02],[-0.07, 0.18, -0.06, -0.08, -0.18, 0.16, -0.02, 0.05, -0.06, -0.08, -0.06],[-0.20, -0.01, -0.04, -0.16, -0.04, -0.11, -0.10, 0.27, 0.21, 0.36, 0.38],[0.03, 0.01, -0.08, -0.12, -0.08, 0.04, 0.52, 0.26, 0.10, -0.06, -0.32],[0.02, -0.03, -0.03, -0.06, 0.05, -0.04, -0.13, 0.05, -0.04, -0.03, 0.17],[0.12, -0.02, -0.02, -0.04, -0.09, -0.01, 0.08, 0.30, -0.10, 0.04, -0.05],[-0.03, 0.04, -0.06, 0.04, -0.10, -0.01, -0.12, -0.08, -0.00, -0.03, 0.18]]},
+ {"i": 70,"j": 68, "score": 0.60, "iC": "DEKPGA", "jC": "DEKRHNSTAVILF", "matrix": [[-0.26, -0.25, 0.26, 0.19, 0.29, -0.08, -0.09, -0.04, -0.05, 0.06, -0.05, -0.02, -0.04],[-0.36, -0.19, 0.14, 0.40, -0.03, -0.19, -0.05, -0.01, 0.36, 0.17, 0.00, -0.11, -0.06],[0.01, 0.07, 0.01, 0.01, 0.04, -0.00, -0.17, 0.07, 0.09, 0.04, -0.04, 0.06, 0.11],[0.26, 0.27, -0.26, -0.19, -0.17, 0.20, 0.35, 0.12, 0.09, 0.05, -0.13, -0.14, -0.13],[0.16, -0.04, -0.06, -0.07, -0.08, 0.04, -0.12, -0.17, -0.09, 0.06, 0.19, 0.19, 0.23],[-0.00, 0.09, -0.01, -0.20, 0.06, -0.03, 0.04, -0.03, 0.16, -0.13, -0.15, -0.01, -0.02]]},
+ {"i": 70,"j": 69, "score": 1.00, "iC": "DEKRHQNSTPGY", "jC": "DEKRNSTPGAVILMFWY", "matrix": [[0.02, -0.16, 0.05, 0.00, 0.04, -0.05, -0.11, -0.05, 0.09, 0.10, 0.07, 0.05, 0.01, -0.07, 0.07, -0.07, -0.00],[-0.36, -0.19, 0.09, 0.28, -0.03, -0.06, -0.17, 0.03, -0.04, 0.22, -0.00, 0.08, -0.12, -0.05, 0.06, -0.04, 0.08],[-0.04, -0.03, -0.03, -0.02, 0.02, -0.04, 0.02, 0.03, 0.06, -0.04, 0.15, 0.03, -0.06, -0.02, 0.04, -0.02, -0.06],[-0.04, 0.16, 0.04, -0.01, -0.04, 0.00, 0.06, -0.00, 0.02, -0.08, 0.04, -0.03, -0.06, -0.01, -0.03, -0.01, -0.01],[0.14, 0.10, 0.00, 0.02, 0.01, -0.01, -0.05, -0.02, 0.04, -0.15, 0.01, -0.01, -0.01, -0.01, -0.04, -0.01, -0.02],[0.03, -0.04, 0.01, -0.01, 0.01, 0.01, -0.04, 0.20, 0.09, 0.11, -0.05, -0.03, -0.08, 0.01, -0.05, -0.02, -0.06],[0.21, 0.20, -0.01, 0.01, 0.05, -0.02, 0.02, -0.05, -0.03, -0.14, -0.09, -0.03, -0.10, -0.02, -0.02, 0.01, -0.06],[0.05, -0.04, 0.06, -0.06, 0.10, 0.07, 0.07, -0.09, -0.01, -0.06, -0.13, -0.08, 0.08, 0.01, 0.02, 0.24, -0.04],[0.08, 0.17, 0.03, 0.02, 0.07, 0.10, 0.05, -0.14, -0.01, -0.11, -0.15, -0.01, -0.01, -0.01, -0.07, -0.02, -0.05],[-0.40, -0.48, -0.23, -0.16, -0.20, -0.28, -0.01, -0.59, -0.32, 0.33, 0.56, 0.21, 0.65, 0.16, 0.24, 0.02, 0.39],[0.12, 0.13, -0.06, 0.06, -0.11, -0.03, 0.09, 0.29, -0.14, 0.03, -0.09, -0.11, 0.14, -0.03, -0.00, -0.03, -0.01],[-0.09, 0.03, 0.05, 0.05, 0.07, 0.15, -0.00, 0.03, 0.04, -0.09, -0.04, -0.02, -0.05, -0.01, -0.05, -0.01, -0.04]]},
+ {"i": 70,"j": 71, "score": 1.16, "iC": "DEHQSPGAIFY", "jC": "DEHQNSPGAC", "matrix": [[-0.29, -0.16, 0.16, 0.08, 0.07, 0.05, -0.12, 0.27, -0.13, 0.00],[-0.42, -0.41, 0.01, -0.03, 0.24, -0.20, -0.24, 0.88, -0.21, -0.07],[-0.02, 0.03, -0.04, -0.01, -0.07, -0.05, 0.51, -0.14, -0.10, 0.01],[0.00, -0.05, 0.03, 0.19, -0.04, -0.05, -0.01, -0.05, -0.05, -0.02],[0.17, -0.11, 0.04, 0.00, 0.02, 0.15, -0.10, -0.28, -0.04, -0.00],[0.07, 0.31, -0.06, -0.14, -0.12, 0.06, -0.27, 0.24, 0.17, -0.11],[0.03, -0.10, -0.03, -0.05, -0.05, 0.01, -0.17, -0.53, 0.58, 0.27],[-0.05, 0.19, -0.04, 0.03, 0.09, -0.05, -0.14, 0.23, -0.04, -0.04],[0.04, 0.30, 0.00, -0.00, -0.06, 0.02, 0.13, -0.24, -0.05, -0.02],[0.11, 0.14, -0.02, -0.02, 0.01, -0.01, -0.07, -0.18, 0.05, -0.01],[0.01, -0.00, 0.05, 0.03, 0.02, 0.06, 0.08, -0.19, -0.02, 0.02]]},
+ {"i": 70,"j": 72, "score": 0.81, "iC": "DEKRHQNPGVIY", "jC": "DERQNSTPGAVC", "matrix": [[-0.19, 0.01, 0.28, -0.10, -0.09, 0.21, -0.09, -0.02, -0.42, -0.03, 0.19, 0.03],[-0.24, -0.17, -0.08, -0.15, -0.28, -0.16, 0.06, -0.03, -0.31, 0.05, 0.04, 0.24],[-0.05, 0.02, -0.00, 0.03, -0.08, -0.06, 0.01, 0.17, -0.22, 0.22, -0.01, 0.10],[0.17, -0.05, -0.03, -0.03, 0.15, -0.01, -0.05, -0.01, 0.11, -0.04, -0.03, -0.02],[0.38, 0.13, -0.02, 0.00, -0.05, 0.02, -0.05, 0.00, -0.03, -0.13, -0.00, -0.11],[-0.06, -0.09, 0.06, -0.06, 0.02, 0.09, -0.07, 0.03, -0.08, 0.21, -0.02, 0.04],[-0.05, -0.03, 0.00, 0.19, 0.12, 0.02, -0.04, -0.00, -0.34, 0.10, -0.06, -0.06],[-0.13, 0.13, -0.16, -0.01, -0.27, -0.01, 0.18, -0.08, 0.32, 0.03, 0.08, 0.24],[0.18, 0.31, 0.11, 0.06, -0.05, -0.06, -0.07, 0.03, -0.13, -0.19, -0.14, -0.14],[-0.05, -0.04, -0.03, -0.01, 0.01, 0.07, 0.01, 0.03, 0.18, -0.07, -0.01, -0.03],[-0.03, -0.03, -0.03, -0.03, 0.09, -0.03, 0.02, -0.02, 0.41, -0.08, -0.05, -0.09],[0.23, 0.03, -0.03, -0.01, 0.22, -0.06, -0.01, -0.03, 0.08, -0.16, -0.02, -0.10]]},
+ {"i": 71,"j": 69, "score": 0.64, "iC": "DEKSPGA", "jC": "DENSTPGAVILCFY", "matrix": [[-0.11, -0.03, 0.11, 0.06, -0.10, -0.24, 0.08, -0.11, 0.04, -0.04, 0.24, -0.03, -0.02, -0.06],[-0.11, 0.02, 0.03, 0.03, 0.01, -0.14, 0.14, -0.06, 0.29, -0.11, 0.01, -0.05, 0.02, -0.06],[0.06, -0.09, 0.08, 0.03, -0.01, -0.18, -0.02, -0.00, 0.01, 0.08, 0.07, -0.02, -0.01, -0.02],[-0.00, 0.12, 0.04, 0.05, 0.16, -0.08, -0.06, 0.03, 0.03, -0.03, -0.05, -0.02, -0.03, 0.01],[0.27, 0.03, 0.07, 0.08, 0.09, 0.08, -0.00, -0.07, -0.08, -0.15, -0.14, -0.02, -0.07, -0.07],[-0.47, -0.22, -0.31, -0.27, -0.14, 0.21, -0.16, 0.52, 0.09, 0.32, -0.27, 0.26, 0.26, 0.21],[0.03, 0.16, -0.02, -0.04, 0.03, 0.12, -0.04, -0.08, -0.11, -0.10, 0.12, -0.03, -0.01, -0.08]]},
+ {"i": 71,"j": 70, "score": 1.16, "iC": "DEHQNSPGAC", "jC": "DEHQSPGAIFY", "matrix": [[-0.29, -0.42, -0.02, 0.00, 0.17, 0.07, 0.03, -0.05, 0.04, 0.11, 0.01],[-0.16, -0.41, 0.03, -0.05, -0.11, 0.31, -0.10, 0.19, 0.30, 0.14, -0.00],[0.16, 0.01, -0.04, 0.03, 0.04, -0.06, -0.03, -0.04, 0.00, -0.02, 0.05],[0.08, -0.03, -0.01, 0.19, 0.00, -0.14, -0.05, 0.03, -0.00, -0.02, 0.03],[0.07, 0.24, -0.07, -0.04, 0.02, -0.12, -0.05, 0.09, -0.06, 0.01, 0.02],[0.05, -0.20, -0.05, -0.05, 0.15, 0.06, 0.01, -0.05, 0.02, -0.01, 0.06],[-0.12, -0.24, 0.51, -0.01, -0.10, -0.27, -0.17, -0.14, 0.13, -0.07, 0.08],[0.27, 0.88, -0.14, -0.05, -0.28, 0.24, -0.53, 0.23, -0.24, -0.18, -0.19],[-0.13, -0.21, -0.10, -0.05, -0.04, 0.17, 0.58, -0.04, -0.05, 0.05, -0.02],[0.00, -0.07, 0.01, -0.02, -0.00, -0.11, 0.27, -0.04, -0.02, -0.01, 0.02]]},
+ {"i": 71,"j": 72, "score": 1.95, "iC": "DEKNSPGACF", "jC": "DEKRQNSTPGAVICF", "matrix": [[-0.07, -0.12, 0.18, 0.06, 0.11, 0.00, 0.08, 0.01, -0.14, 0.14, 0.22, -0.11, -0.05, -0.13, -0.04],[-0.18, -0.04, 0.01, 0.24, -0.00, 0.57, 0.17, -0.05, -0.11, 0.72, -0.38, -0.13, -0.07, -0.32, -0.04],[0.37, 0.01, -0.01, -0.04, -0.05, 0.04, -0.05, 0.01, 0.02, 0.09, -0.13, -0.03, -0.03, -0.05, -0.02],[-0.15, -0.02, 0.02, -0.02, 0.03, -0.08, -0.05, 0.07, -0.03, -0.13, 0.06, -0.04, -0.03, 0.30, 0.01],[0.05, 0.06, -0.08, 0.04, -0.03, 0.02, -0.01, 0.06, 0.18, -0.03, -0.05, -0.07, 0.01, -0.10, -0.00],[0.31, 0.27, -0.01, 0.01, 0.11, 0.16, 0.06, -0.11, -0.07, 0.07, -0.21, -0.10, -0.02, -0.23, -0.02],[-0.72, -0.48, -0.14, -0.25, -0.22, -0.64, -0.27, 0.19, -0.23, -1.17, 0.96, 0.57, 0.21, 0.75, 0.19],[0.07, 0.31, -0.02, -0.06, 0.16, -0.05, 0.01, -0.02, 0.16, 0.15, -0.26, -0.14, -0.05, -0.15, -0.02],[0.25, 0.01, -0.01, -0.01, 0.01, 0.01, -0.02, -0.03, 0.04, -0.09, -0.08, -0.02, -0.01, -0.07, -0.00],[-0.03, 0.04, 0.02, -0.01, -0.01, -0.03, -0.01, -0.01, 0.15, -0.07, -0.04, -0.01, -0.00, -0.02, -0.00]]},
+ {"i": 72,"j": 46, "score": 0.63, "iC": "EAVC", "jC": "HFWY", "matrix": [[0.00, -0.13, 0.00, 0.16],[-0.27, -0.28, 0.75, -0.18],[-0.05, 0.25, -0.24, -0.03],[0.38, -0.18, -0.38, 0.13]]},
+ {"i": 72,"j": 67, "score": 0.47, "iC": "NGAVIC", "jC": "SPGLFWY", "matrix": [[-0.07, 0.28, -0.06, 0.08, -0.01, -0.12, -0.11],[0.01, -0.04, 0.25, -0.01, -0.22, -0.17, -0.16],[-0.19, -0.03, -0.07, 0.14, -0.05, 0.16, 0.49],[-0.07, -0.04, -0.00, -0.07, 0.20, 0.48, -0.20],[-0.03, -0.02, -0.01, -0.07, 0.02, -0.02, 0.21],[-0.02, -0.03, -0.04, 0.19, 0.20, -0.34, 0.11]]},
+ {"i": 72,"j": 69, "score": 0.61, "iC": "DERQNPGAVIC", "jC": "DERHNTPAVILF", "matrix": [[0.04, 0.06, 0.09, 0.02, 0.08, -0.05, -0.07, -0.20, 0.03, 0.02, 0.12, -0.03],[-0.09, 0.07, -0.06, -0.02, 0.06, -0.03, 0.18, -0.01, 0.01, -0.03, -0.02, 0.04],[0.19, 0.08, 0.01, 0.00, 0.02, -0.01, -0.06, -0.04, -0.08, -0.03, -0.02, -0.06],[0.20, 0.00, -0.00, 0.07, 0.02, 0.00, -0.08, -0.16, -0.12, -0.06, -0.04, 0.04],[0.09, -0.03, 0.07, -0.07, 0.10, 0.28, -0.18, -0.04, -0.08, 0.05, -0.09, -0.10],[-0.06, 0.09, 0.05, -0.02, 0.02, -0.03, 0.16, -0.11, 0.04, -0.04, -0.01, -0.01],[-0.09, 0.06, -0.09, -0.17, -0.16, 0.05, -0.02, -0.10, 0.52, -0.13, 0.08, -0.12],[-0.15, -0.20, -0.17, -0.11, -0.16, 0.00, 0.05, 0.27, 0.26, 0.05, 0.30, -0.08],[-0.11, -0.15, 0.02, 0.27, -0.05, 0.00, -0.06, 0.21, 0.10, -0.04, -0.10, -0.00],[-0.05, -0.03, 0.04, -0.05, 0.01, -0.03, -0.08, 0.36, -0.06, -0.03, 0.04, -0.03],[-0.17, -0.12, -0.04, -0.11, -0.02, -0.02, -0.06, 0.38, -0.32, 0.17, -0.05, 0.18]]},
+ {"i": 72,"j": 70, "score": 0.81, "iC": "DERQNSTPGAVC", "jC": "DEKRHQNPGVIY", "matrix": [[-0.19, -0.24, -0.05, 0.17, 0.38, -0.06, -0.05, -0.13, 0.18, -0.05, -0.03, 0.23],[0.01, -0.17, 0.02, -0.05, 0.13, -0.09, -0.03, 0.13, 0.31, -0.04, -0.03, 0.03],[0.28, -0.08, -0.00, -0.03, -0.02, 0.06, 0.00, -0.16, 0.11, -0.03, -0.03, -0.03],[-0.10, -0.15, 0.03, -0.03, 0.00, -0.06, 0.19, -0.01, 0.06, -0.01, -0.03, -0.01],[-0.09, -0.28, -0.08, 0.15, -0.05, 0.02, 0.12, -0.27, -0.05, 0.01, 0.09, 0.22],[0.21, -0.16, -0.06, -0.01, 0.02, 0.09, 0.02, -0.01, -0.06, 0.07, -0.03, -0.06],[-0.09, 0.06, 0.01, -0.05, -0.05, -0.07, -0.04, 0.18, -0.07, 0.01, 0.02, -0.01],[-0.02, -0.03, 0.17, -0.01, 0.00, 0.03, -0.00, -0.08, 0.03, 0.03, -0.02, -0.03],[-0.42, -0.31, -0.22, 0.11, -0.03, -0.08, -0.34, 0.32, -0.13, 0.18, 0.41, 0.08],[-0.03, 0.05, 0.22, -0.04, -0.13, 0.21, 0.10, 0.03, -0.19, -0.07, -0.08, -0.16],[0.19, 0.04, -0.01, -0.03, -0.00, -0.02, -0.06, 0.08, -0.14, -0.01, -0.05, -0.02],[0.03, 0.24, 0.10, -0.02, -0.11, 0.04, -0.06, 0.24, -0.14, -0.03, -0.09, -0.10]]},
+ {"i": 72,"j": 71, "score": 1.95, "iC": "DEKRQNSTPGAVICF", "jC": "DEKNSPGACF", "matrix": [[-0.07, -0.18, 0.37, -0.15, 0.05, 0.31, -0.72, 0.07, 0.25, -0.03],[-0.12, -0.04, 0.01, -0.02, 0.06, 0.27, -0.48, 0.31, 0.01, 0.04],[0.18, 0.01, -0.01, 0.02, -0.08, -0.01, -0.14, -0.02, -0.01, 0.02],[0.06, 0.24, -0.04, -0.02, 0.04, 0.01, -0.25, -0.06, -0.01, -0.01],[0.11, -0.00, -0.05, 0.03, -0.03, 0.11, -0.22, 0.16, 0.01, -0.01],[0.00, 0.57, 0.04, -0.08, 0.02, 0.16, -0.64, -0.05, 0.01, -0.03],[0.08, 0.17, -0.05, -0.05, -0.01, 0.06, -0.27, 0.01, -0.02, -0.01],[0.01, -0.05, 0.01, 0.07, 0.06, -0.11, 0.19, -0.02, -0.03, -0.01],[-0.14, -0.11, 0.02, -0.03, 0.18, -0.07, -0.23, 0.16, 0.04, 0.15],[0.14, 0.72, 0.09, -0.13, -0.03, 0.07, -1.17, 0.15, -0.09, -0.07],[0.22, -0.38, -0.13, 0.06, -0.05, -0.21, 0.96, -0.26, -0.08, -0.04],[-0.11, -0.13, -0.03, -0.04, -0.07, -0.10, 0.57, -0.14, -0.02, -0.01],[-0.05, -0.07, -0.03, -0.03, 0.01, -0.02, 0.21, -0.05, -0.01, -0.00],[-0.13, -0.32, -0.05, 0.30, -0.10, -0.23, 0.75, -0.15, -0.07, -0.02],[-0.04, -0.04, -0.02, 0.01, -0.00, -0.02, 0.19, -0.02, -0.00, -0.00]]},
+ {"i": 72,"j": 73, "score": 1.08, "iC": "DHNSGAVIC", "jC": "DEKHQTAVILF", "matrix": [[-0.09, -0.21, -0.05, 0.01, -0.06, -0.12, 0.09, 0.24, 0.11, -0.02, 0.07],[-0.01, -0.01, 0.03, 0.15, 0.06, -0.05, 0.04, -0.08, 0.01, -0.07, -0.06],[-0.07, 0.10, 0.21, -0.13, 0.05, -0.07, -0.02, -0.06, 0.11, -0.05, 0.05],[-0.03, -0.10, 0.04, 0.01, -0.03, 0.00, -0.05, 0.12, 0.01, 0.17, 0.05],[0.02, 0.14, -0.18, 0.17, -0.08, -0.02, -0.06, 0.05, 0.04, 0.23, 0.20],[-0.18, -0.72, -0.18, -0.02, -0.19, -0.04, -0.16, 0.30, 0.18, -0.04, -0.02],[0.63, 0.81, 0.29, -0.06, 0.14, -0.30, 0.08, -0.20, -0.29, -0.29, -0.12],[0.05, 0.50, 0.04, -0.04, 0.04, -0.04, 0.02, -0.11, -0.11, -0.11, -0.02],[-0.17, -0.31, -0.21, -0.08, -0.10, 0.04, -0.01, 0.01, 0.25, 0.35, 0.00]]},
+ {"i": 73,"j": 57, "score": 1.76, "iC": "DEKRHSTAVILFY", "jC": "DEKRHQTPAVILF", "matrix": [[-0.03, -0.12, 0.06, 0.48, 0.08, 0.10, -0.22, -0.00, -0.03, -0.05, -0.05, -0.15, -0.02],[-0.15, -0.37, 0.32, 1.19, 0.09, -0.05, -0.20, -0.08, -0.08, -0.06, -0.19, -0.27, -0.06],[-0.02, 0.23, -0.10, -0.26, -0.13, -0.09, -0.03, -0.00, -0.01, 0.02, 0.03, 0.05, 0.02],[0.14, 0.47, -0.12, -0.54, -0.09, -0.02, 0.11, -0.13, 0.16, 0.01, -0.00, 0.03, 0.01],[-0.02, 0.34, -0.01, -0.22, -0.08, -0.03, -0.01, 0.15, 0.01, 0.06, 0.20, -0.18, -0.08],[0.14, -0.03, 0.11, -0.22, 0.39, 0.04, -0.19, 0.03, 0.03, -0.09, -0.13, -0.06, 0.01],[0.21, 0.46, -0.11, -0.52, 0.53, 0.09, -0.34, 0.09, -0.06, -0.18, -0.15, -0.14, -0.06],[0.00, 0.01, 0.02, -0.11, -0.05, -0.05, -0.15, 0.08, -0.01, -0.03, -0.04, 0.08, 0.13],[-0.21, -0.17, -0.04, -0.34, -0.12, -0.14, 0.41, -0.19, -0.08, 0.07, -0.03, 0.48, 0.15],[-0.00, -0.22, -0.13, -0.30, -0.27, -0.04, 0.65, -0.05, 0.09, 0.18, 0.09, 0.12, -0.01],[0.03, -0.11, -0.08, -0.46, -0.22, 0.16, 0.55, -0.13, -0.09, 0.12, 0.05, 0.29, 0.01],[-0.03, -0.07, 0.18, -0.11, 0.00, -0.01, 0.02, 0.03, -0.00, 0.01, 0.20, -0.09, -0.00],[0.02, -0.04, -0.03, -0.09, -0.06, -0.07, 0.07, 0.11, 0.08, 0.11, 0.27, -0.16, -0.05]]},
+ {"i": 73,"j": 72, "score": 1.08, "iC": "DEKHQTAVILF", "jC": "DHNSGAVIC", "matrix": [[-0.09, -0.01, -0.07, -0.03, 0.02, -0.18, 0.63, 0.05, -0.17],[-0.21, -0.01, 0.10, -0.10, 0.14, -0.72, 0.81, 0.50, -0.31],[-0.05, 0.03, 0.21, 0.04, -0.18, -0.18, 0.29, 0.04, -0.21],[0.01, 0.15, -0.13, 0.01, 0.17, -0.02, -0.06, -0.04, -0.08],[-0.06, 0.06, 0.05, -0.03, -0.08, -0.19, 0.14, 0.04, -0.10],[-0.12, -0.05, -0.07, 0.00, -0.02, -0.04, -0.30, -0.04, 0.04],[0.09, 0.04, -0.02, -0.05, -0.06, -0.16, 0.08, 0.02, -0.01],[0.24, -0.08, -0.06, 0.12, 0.05, 0.30, -0.20, -0.11, 0.01],[0.11, 0.01, 0.11, 0.01, 0.04, 0.18, -0.29, -0.11, 0.25],[-0.02, -0.07, -0.05, 0.17, 0.23, -0.04, -0.29, -0.11, 0.35],[0.07, -0.06, 0.05, 0.05, 0.20, -0.02, -0.12, -0.02, 0.00]]},
+ {"i": 73,"j": 75, "score": 0.51, "iC": "ERHTVILY", "jC": "SAVLCFY", "matrix": [[-0.05, 0.05, -0.08, -0.01, -0.23, 0.16, 0.14],[-0.02, -0.11, 0.06, -0.04, 0.05, 0.16, 0.14],[0.02, 0.15, 0.08, -0.04, -0.15, 0.08, -0.04],[-0.12, -0.15, 0.30, 0.11, 0.08, -0.26, -0.19],[-0.02, 0.04, 0.17, 0.18, 0.04, -0.29, -0.16],[0.05, -0.08, 0.13, 0.12, 0.30, -0.44, -0.12],[-0.12, 0.15, -0.43, -0.07, 0.15, 0.35, -0.00],[0.15, -0.01, -0.09, -0.02, 0.03, -0.04, 0.02]]},
+ {"i": 73,"j": 84, "score": 0.62, "iC": "EKRHSTVILFY", "jC": "EKRAVILFWY", "matrix": [[-0.12, 0.18, 0.40, 0.07, -0.10, -0.09, 0.12, -0.11, -0.00, -0.13],[-0.01, -0.16, -0.14, -0.01, -0.00, 0.03, 0.03, 0.09, 0.05, 0.07],[0.06, -0.12, -0.23, 0.13, 0.09, -0.03, 0.09, -0.05, 0.03, -0.06],[-0.15, 0.06, -0.17, -0.20, -0.08, 0.19, 0.19, 0.17, 0.01, -0.01],[-0.02, -0.02, -0.02, -0.10, 0.05, 0.01, 0.19, -0.03, -0.01, -0.02],[0.01, -0.11, -0.10, 0.32, 0.20, -0.04, -0.28, -0.01, -0.08, 0.03],[0.21, 0.14, -0.04, 0.22, 0.08, -0.11, -0.43, 0.04, -0.01, 0.21],[0.28, 0.06, 0.07, 0.15, 0.09, 0.03, -0.55, -0.20, -0.09, 0.08],[0.03, 0.01, -0.15, 0.08, -0.14, -0.01, 0.04, -0.06, 0.16, 0.00],[-0.02, -0.04, 0.01, -0.18, 0.00, 0.06, 0.14, 0.10, -0.01, -0.08],[-0.06, -0.03, 0.07, -0.12, -0.04, 0.10, 0.18, 0.11, -0.00, -0.01]]},
+ {"i": 74,"j": 62, "score": 0.68, "iC": "HPAILW", "jC": "ST", "matrix": [[0.30, -0.28],[-0.15, 0.07],[-0.23, 0.23],[-0.27, 0.35],[0.37, -0.48],[0.31, -0.30]]},
+ {"i": 74,"j": 67, "score": 0.49, "iC": "RAVILMCFW", "jC": "EKPLFWY", "matrix": [[-0.07, -0.04, 0.03, 0.07, 0.00, 0.25, -0.03],[-0.03, 0.07, -0.07, -0.18, 0.02, 0.26, -0.19],[-0.21, -0.07, -0.18, 0.11, 0.36, 0.02, 0.38],[-0.02, 0.03, 0.05, 0.00, 0.28, -0.23, 0.31],[0.10, -0.01, 0.09, -0.04, -0.12, -0.27, 0.26],[0.01, 0.02, -0.03, 0.17, -0.07, -0.11, -0.01],[0.00, -0.01, -0.04, 0.16, -0.10, -0.02, -0.06],[0.15, 0.16, 0.04, -0.04, -0.18, -0.08, -0.05],[0.05, 0.00, 0.18, -0.19, -0.17, -0.11, -0.20]]},
+ {"i": 74,"j": 75, "score": 0.42, "iC": "HSAVIMCFW", "jC": "RAVMFY", "matrix": [[-0.01, 0.30, -0.18, 0.01, -0.02, 0.00],[-0.01, 0.08, -0.15, -0.02, 0.16, -0.06],[0.01, -0.24, 0.35, 0.01, -0.02, 0.01],[0.15, -0.39, -0.04, 0.16, 0.10, 0.15],[-0.06, 0.10, -0.18, 0.00, -0.04, -0.09],[-0.01, 0.35, -0.23, 0.01, -0.08, -0.02],[-0.01, -0.14, 0.09, 0.02, 0.15, 0.07],[-0.01, -0.28, 0.18, -0.02, -0.00, -0.00],[-0.01, -0.16, 0.09, -0.02, 0.02, -0.02]]},
+ {"i": 74,"j": 76, "score": 0.83, "iC": "RSTVILMCF", "jC": "EKRHNSTPGAY", "matrix": [[0.04, -0.04, -0.10, -0.44, -0.10, 0.21, -0.18, -0.07, 0.24, 0.38, -0.05],[0.03, 0.05, -0.09, -0.11, -0.04, -0.05, 0.27, 0.00, -0.14, 0.07, -0.02],[-0.03, -0.06, -0.03, -0.06, -0.11, 0.08, 0.31, -0.00, -0.09, -0.03, -0.08],[-0.18, -0.17, 0.14, 0.69, 0.23, -0.06, -0.22, 0.21, 0.05, -0.32, -0.07],[0.05, -0.07, 0.18, 0.51, 0.04, -0.23, -0.32, -0.03, 0.00, -0.10, -0.02],[-0.04, 0.06, -0.07, 0.26, 0.22, -0.05, -0.16, -0.00, -0.03, -0.15, 0.02],[0.03, -0.06, 0.09, 0.09, -0.05, -0.04, -0.05, -0.06, 0.03, -0.06, 0.15],[-0.03, 0.15, -0.07, -0.08, -0.09, 0.07, 0.07, 0.02, -0.03, 0.02, -0.01],[0.02, 0.03, 0.00, -0.15, 0.05, 0.02, 0.12, 0.02, -0.04, -0.06, 0.00]]},
+ {"i": 75,"j": 59, "score": 0.90, "iC": "HTAVIMF", "jC": "AVILFWY", "matrix": [[-0.02, -0.09, -0.12, 0.25, 0.03, -0.01, -0.03],[-0.02, -0.12, 0.24, -0.07, -0.01, -0.02, -0.00],[-0.05, 0.47, 0.43, -0.43, -0.17, 0.00, -0.15],[-0.11, -0.01, 0.39, -0.07, 0.12, -0.13, 0.02],[-0.03, -0.00, -0.23, 0.03, 0.09, -0.04, 0.28],[-0.01, -0.11, 0.16, -0.05, 0.09, -0.01, -0.03],[0.20, -0.32, -0.60, 0.42, 0.02, 0.22, -0.00]]},
+ {"i": 75,"j": 73, "score": 0.51, "iC": "SAVLCFY", "jC": "ERHTVILY", "matrix": [[-0.05, -0.02, 0.02, -0.12, -0.02, 0.05, -0.12, 0.15],[0.05, -0.11, 0.15, -0.15, 0.04, -0.08, 0.15, -0.01],[-0.08, 0.06, 0.08, 0.30, 0.17, 0.13, -0.43, -0.09],[-0.01, -0.04, -0.04, 0.11, 0.18, 0.12, -0.07, -0.02],[-0.23, 0.05, -0.15, 0.08, 0.04, 0.30, 0.15, 0.03],[0.16, 0.16, 0.08, -0.26, -0.29, -0.44, 0.35, -0.04],[0.14, 0.14, -0.04, -0.19, -0.16, -0.12, -0.00, 0.02]]},
+ {"i": 75,"j": 74, "score": 0.42, "iC": "RAVMFY", "jC": "HSAVIMCFW", "matrix": [[-0.01, -0.01, 0.01, 0.15, -0.06, -0.01, -0.01, -0.01, -0.01],[0.30, 0.08, -0.24, -0.39, 0.10, 0.35, -0.14, -0.28, -0.16],[-0.18, -0.15, 0.35, -0.04, -0.18, -0.23, 0.09, 0.18, 0.09],[0.01, -0.02, 0.01, 0.16, 0.00, 0.01, 0.02, -0.02, -0.02],[-0.02, 0.16, -0.02, 0.10, -0.04, -0.08, 0.15, -0.00, 0.02],[0.00, -0.06, 0.01, 0.15, -0.09, -0.02, 0.07, -0.00, -0.02]]},
+ {"i": 75,"j": 80, "score": 0.39, "iC": "EKSTAVLCY", "jC": "DEKQNSGA", "matrix": [[-0.06, -0.11, 0.03, -0.03, 0.02, 0.19, -0.01, 0.02],[-0.00, -0.07, -0.03, -0.02, -0.01, 0.15, -0.01, 0.02],[0.27, -0.09, 0.02, -0.09, 0.02, -0.05, 0.06, -0.13],[-0.06, -0.06, 0.07, 0.05, 0.16, -0.05, -0.05, -0.08],[-0.09, 0.22, -0.20, 0.20, 0.10, -0.17, 0.16, -0.18],[-0.02, 0.33, -0.02, 0.15, -0.17, -0.20, -0.08, 0.16],[-0.05, 0.05, 0.06, -0.06, -0.04, 0.02, -0.06, 0.19],[0.03, 0.11, -0.05, 0.04, -0.10, 0.18, -0.05, -0.12],[0.01, -0.29, 0.04, -0.07, -0.07, 0.08, 0.07, 0.12]]},
+ {"i": 75,"j": 81, "score": 0.67, "iC": "AVILMF", "jC": "GAVILMF", "matrix": [[0.18, 0.41, 0.00, -0.20, -0.21, -0.05, -0.10],[0.27, 0.37, -0.38, -0.13, 0.10, -0.05, 0.00],[-0.03, -0.29, -0.14, 0.21, 0.19, -0.02, 0.05],[-0.08, -0.37, 0.41, 0.02, -0.05, -0.01, 0.02],[-0.03, -0.19, 0.20, 0.03, -0.01, 0.01, -0.02],[-0.16, 0.01, -0.06, -0.12, -0.02, 0.18, 0.18]]},
+ {"i": 75,"j": 84, "score": 1.43, "iC": "RHAVILMCFY", "jC": "DEKHNSAVILMFWY", "matrix": [[0.04, 0.30, -0.02, 0.00, -0.02, -0.01, -0.04, -0.01, -0.03, -0.10, -0.02, -0.03, -0.02, -0.02],[0.03, 0.06, -0.02, 0.04, -0.02, 0.06, 0.15, -0.01, -0.04, -0.17, -0.03, 0.02, -0.02, -0.05],[-0.17, -0.31, 0.13, -0.03, -0.06, -0.14, -0.41, -0.22, 0.50, 0.63, 0.59, -0.12, -0.07, -0.15],[-0.19, 0.14, 0.03, -0.20, -0.16, -0.08, 0.22, 0.29, 0.04, 0.40, -0.20, -0.25, -0.11, -0.31],[0.03, -0.03, 0.00, 0.07, 0.05, -0.05, -0.23, 0.02, 0.07, 0.29, 0.09, -0.11, 0.00, -0.10],[-0.01, -0.03, -0.12, -0.01, 0.04, -0.06, -0.18, 0.03, -0.12, 0.16, -0.04, 0.11, 0.07, 0.34],[-0.02, -0.06, -0.04, -0.01, -0.02, -0.00, -0.07, -0.02, -0.08, -0.07, -0.01, 0.12, 0.07, 0.20],[-0.06, -0.01, 0.13, -0.06, -0.01, -0.12, -0.07, 0.16, 0.17, 0.03, -0.00, -0.17, -0.01, -0.09],[-0.05, -0.13, -0.23, 0.13, 0.07, 0.19, 0.53, -0.12, -0.37, -0.85, -0.23, 0.48, 0.22, 0.37],[0.28, 0.04, 0.04, 0.12, 0.13, 0.18, 0.34, -0.11, -0.17, -0.43, -0.10, -0.12, -0.05, -0.03]]},
+ {"i": 76,"j": 62, "score": 0.60, "iC": "KRHNY", "jC": "ST", "matrix": [[0.11, -0.15],[0.27, -0.38],[-0.40, 0.51],[-0.18, 0.27],[-0.24, 0.25]]},
+ {"i": 76,"j": 65, "score": 0.64, "iC": "DKRHNSTPGAY", "jC": "DEKRQTPGALM", "matrix": [[-0.04, -0.16, 0.12, -0.10, -0.04, -0.16, 0.08, 0.07, 0.09, 0.06, 0.06],[0.17, 0.09, -0.13, -0.08, 0.03, 0.02, -0.07, -0.02, -0.08, 0.02, -0.07],[0.12, 0.24, -0.22, -0.24, -0.09, -0.17, 0.04, -0.03, -0.03, 0.14, 0.41],[0.08, 0.12, -0.11, 0.23, 0.17, 0.30, -0.32, -0.38, -0.33, 0.21, 0.11],[-0.02, 0.09, 0.05, -0.11, 0.10, -0.06, -0.18, -0.10, 0.04, -0.10, 0.05],[-0.12, -0.09, 0.00, -0.02, -0.04, 0.19, 0.08, 0.03, -0.08, -0.07, -0.06],[0.07, 0.10, -0.15, -0.15, -0.03, -0.01, 0.19, 0.17, 0.28, -0.16, -0.14],[-0.08, -0.07, -0.04, 0.09, -0.04, -0.14, 0.11, -0.03, 0.09, 0.19, -0.06],[-0.01, -0.02, -0.04, 0.07, -0.13, 0.02, 0.14, 0.11, -0.00, -0.17, -0.05],[-0.03, -0.09, -0.10, -0.02, 0.11, -0.05, -0.03, 0.11, 0.19, -0.00, -0.07],[-0.01, -0.04, 0.25, 0.17, 0.02, -0.01, -0.09, -0.02, -0.12, -0.04, -0.03]]},
+ {"i": 76,"j": 74, "score": 0.83, "iC": "EKRHNSTPGAY", "jC": "RSTVILMCF", "matrix": [[0.04, 0.03, -0.03, -0.18, 0.05, -0.04, 0.03, -0.03, 0.02],[-0.04, 0.05, -0.06, -0.17, -0.07, 0.06, -0.06, 0.15, 0.03],[-0.10, -0.09, -0.03, 0.14, 0.18, -0.07, 0.09, -0.07, 0.00],[-0.44, -0.11, -0.06, 0.69, 0.51, 0.26, 0.09, -0.08, -0.15],[-0.10, -0.04, -0.11, 0.23, 0.04, 0.22, -0.05, -0.09, 0.05],[0.21, -0.05, 0.08, -0.06, -0.23, -0.05, -0.04, 0.07, 0.02],[-0.18, 0.27, 0.31, -0.22, -0.32, -0.16, -0.05, 0.07, 0.12],[-0.07, 0.00, -0.00, 0.21, -0.03, -0.00, -0.06, 0.02, 0.02],[0.24, -0.14, -0.09, 0.05, 0.00, -0.03, 0.03, -0.03, -0.04],[0.38, 0.07, -0.03, -0.32, -0.10, -0.15, -0.06, 0.02, -0.06],[-0.05, -0.02, -0.08, -0.07, -0.02, 0.02, 0.15, -0.01, 0.00]]},
+ {"i": 76,"j": 80, "score": 1.15, "iC": "DEKRHNSPGA", "jC": "DEKQNSTA", "matrix": [[-0.40, -0.76, 0.66, -0.23, 0.21, 0.24, 0.09, 0.05],[-0.00, -0.16, 0.07, 0.05, -0.03, -0.02, -0.00, -0.01],[0.16, 0.28, -0.08, -0.02, -0.07, -0.10, -0.04, -0.11],[0.19, 0.42, -0.04, -0.12, -0.02, -0.07, -0.02, -0.16],[0.24, 0.52, -0.32, -0.01, -0.18, 0.01, -0.03, -0.15],[-0.10, -0.40, 0.07, 0.07, 0.17, 0.02, 0.03, 0.08],[-0.04, 0.04, -0.05, 0.09, 0.12, -0.16, -0.12, -0.03],[-0.25, -0.28, -0.08, -0.15, -0.10, 0.16, 0.17, 0.44],[-0.08, 0.50, -0.07, 0.02, -0.05, -0.16, -0.06, -0.00],[0.02, 0.17, -0.12, 0.17, -0.07, -0.11, 0.00, 0.06]]},
+ {"i": 77,"j": 79, "score": 0.60, "iC": "DSTG", "jC": "DERHQNS", "matrix": [[-0.31, -0.53, 0.16, 0.06, -0.08, 0.17, 0.18],[0.30, 0.46, -0.04, -0.16, 0.08, -0.13, -0.05],[-0.19, 0.16, -0.07, 0.02, 0.18, -0.09, -0.04],[0.19, -0.01, 0.02, 0.04, -0.06, -0.03, 0.00]]},
+ {"i": 77,"j": 80, "score": 1.16, "iC": "DENSTG", "jC": "DEKNSTGA", "matrix": [[-0.71, -0.80, 0.11, -0.07, 0.62, 0.55, 0.17, 0.22],[-0.16, -0.01, 0.03, -0.01, -0.06, 0.00, -0.02, 0.04],[0.25, 0.06, -0.18, 0.02, 0.05, -0.03, -0.04, -0.05],[0.05, 0.45, 0.04, 0.16, -0.31, -0.38, -0.03, 0.08],[0.16, 0.25, -0.02, -0.10, -0.15, -0.19, -0.02, -0.03],[0.05, 0.28, 0.04, -0.04, -0.07, -0.06, -0.01, -0.13]]},
+ {"i": 78,"j": 79, "score": 0.38, "iC": "PVILM", "jC": "DERHQSTPAL", "matrix": [[-0.38, 0.19, 0.12, 0.00, 0.20, 0.00, -0.07, -0.15, 0.01, 0.02],[-0.01, 0.29, -0.07, -0.06, 0.02, -0.00, -0.07, 0.09, 0.05, -0.06],[0.10, -0.04, -0.18, 0.17, -0.27, 0.18, 0.05, 0.18, -0.20, 0.14],[0.12, -0.05, 0.02, -0.02, -0.14, -0.03, 0.21, 0.01, 0.06, -0.17],[0.20, -0.10, -0.03, -0.01, 0.01, -0.00, -0.00, -0.06, 0.00, 0.05]]},
+ {"i": 78,"j": 102, "score": 0.70, "iC": "KPVILFW", "jC": "DEQSTAILMY", "matrix": [[0.01, -0.08, -0.09, -0.05, 0.00, -0.06, -0.00, 0.18, 0.21, -0.01],[0.02, -0.16, -0.38, -0.02, 0.09, 0.19, 0.20, -0.04, -0.00, 0.17],[-0.04, -0.05, 0.13, 0.15, -0.07, 0.20, -0.00, -0.10, -0.18, 0.01],[-0.04, 0.06, 0.44, 0.08, -0.04, 0.17, -0.18, -0.24, -0.21, 0.04],[0.03, 0.42, 0.52, -0.20, -0.18, -0.01, -0.03, -0.08, -0.07, -0.14],[-0.05, 0.00, -0.10, -0.09, 0.04, -0.25, -0.01, 0.19, 0.12, 0.00],[0.18, -0.01, -0.15, -0.01, 0.01, -0.11, 0.01, 0.10, -0.02, -0.01]]},
+ {"i": 78,"j": 103, "score": 1.44, "iC": "KPAVILMFW", "jC": "STGALMCFY", "matrix": [[-0.03, -0.09, -0.02, -0.09, -0.06, 0.01, -0.02, 0.31, 0.01],[-0.04, -0.13, -0.06, -0.49, 0.18, 0.05, -0.12, 0.57, 0.16],[-0.05, -0.03, 0.02, -0.19, 0.08, 0.12, -0.03, 0.16, -0.03],[-0.15, 0.47, -0.26, -0.50, -0.01, 0.07, 0.21, 0.26, -0.10],[-0.05, 0.21, -0.17, -0.35, 0.16, 0.24, 0.10, -0.09, -0.18],[0.35, -0.03, 0.25, 0.87, -0.23, -0.39, 0.06, -0.76, -0.12],[-0.05, -0.13, 0.17, 0.11, 0.03, -0.05, -0.02, -0.14, 0.14],[-0.01, -0.13, 0.11, 0.65, -0.09, -0.16, -0.09, -0.30, -0.03],[0.05, -0.03, -0.02, 0.23, -0.06, -0.04, -0.02, -0.17, -0.01]]},
+ {"i": 78,"j": 106, "score": 0.47, "iC": "KRPVILMF", "jC": "DEHQAILMFY", "matrix": [[0.28, 0.34, -0.14, 0.04, 0.02, -0.06, -0.11, -0.01, -0.08, -0.16],[0.22, 0.02, -0.06, -0.02, 0.01, 0.07, 0.00, -0.02, -0.04, -0.07],[-0.10, -0.10, -0.08, 0.18, -0.05, -0.09, 0.10, 0.02, -0.02, -0.03],[-0.30, -0.10, 0.24, -0.10, 0.25, -0.17, 0.14, -0.07, 0.07, 0.32],[-0.12, -0.13, 0.01, -0.14, -0.04, -0.07, 0.08, 0.08, -0.07, 0.16],[-0.08, -0.07, -0.20, -0.16, -0.12, 0.25, 0.16, 0.18, -0.16, -0.11],[0.01, 0.03, -0.01, -0.01, -0.03, -0.04, 0.02, -0.05, 0.17, -0.00],[-0.05, -0.05, 0.07, 0.13, 0.01, 0.09, -0.23, -0.11, 0.05, 0.00]]},
+ {"i": 79,"j": 77, "score": 0.60, "iC": "DERHQNS", "jC": "DSTG", "matrix": [[-0.31, 0.30, -0.19, 0.19],[-0.53, 0.46, 0.16, -0.01],[0.16, -0.04, -0.07, 0.02],[0.06, -0.16, 0.02, 0.04],[-0.08, 0.08, 0.18, -0.06],[0.17, -0.13, -0.09, -0.03],[0.18, -0.05, -0.04, 0.00]]},
+ {"i": 79,"j": 78, "score": 0.38, "iC": "DERHQSTPAL", "jC": "PVILM", "matrix": [[-0.38, -0.01, 0.10, 0.12, 0.20],[0.19, 0.29, -0.04, -0.05, -0.10],[0.12, -0.07, -0.18, 0.02, -0.03],[0.00, -0.06, 0.17, -0.02, -0.01],[0.20, 0.02, -0.27, -0.14, 0.01],[0.00, -0.00, 0.18, -0.03, -0.00],[-0.07, -0.07, 0.05, 0.21, -0.00],[-0.15, 0.09, 0.18, 0.01, -0.06],[0.01, 0.05, -0.20, 0.06, 0.00],[0.02, -0.06, 0.14, -0.17, 0.05]]},
+ {"i": 79,"j": 83, "score": 0.45, "iC": "DEKQPA", "jC": "DEKRQSAL", "matrix": [[-0.16, -0.10, 0.12, 0.15, -0.19, -0.11, 0.24, 0.24],[-0.27, -0.07, 0.15, 0.24, 0.11, 0.04, 0.04, -0.16],[0.19, 0.14, -0.01, -0.07, -0.05, -0.09, -0.11, 0.02],[0.44, -0.20, -0.17, 0.00, -0.02, -0.09, -0.09, 0.04],[-0.25, 0.07, -0.02, -0.06, 0.06, 0.08, 0.23, -0.01],[-0.04, 0.13, -0.05, 0.01, -0.01, -0.15, 0.10, -0.07]]},
+ {"i": 79,"j": 106, "score": 0.82, "iC": "DEKQNPAL", "jC": "DEKRHQSVILFY", "matrix": [[-0.07, -0.16, 0.39, 1.00, 0.20, -0.20, -0.21, -0.01, -0.08, -0.25, -0.22, -0.20],[-0.21, -0.08, 0.09, 0.11, 0.08, -0.12, -0.01, -0.15, -0.08, 0.10, 0.05, 0.06],[-0.00, -0.01, -0.04, -0.15, -0.07, 0.13, -0.06, -0.01, -0.00, -0.07, 0.05, 0.26],[0.09, 0.11, -0.23, -0.22, -0.18, 0.03, -0.04, 0.10, -0.11, 0.36, 0.09, 0.05],[0.03, -0.04, 0.04, 0.09, -0.02, -0.06, 0.03, -0.01, 0.16, -0.14, 0.03, -0.03],[0.03, 0.08, -0.03, -0.28, 0.04, 0.04, 0.06, 0.02, 0.04, -0.05, -0.03, 0.11],[0.06, 0.03, -0.13, -0.33, -0.06, 0.11, 0.07, 0.05, -0.01, 0.04, 0.06, -0.05],[-0.02, -0.02, -0.02, -0.04, 0.02, 0.11, -0.01, -0.01, 0.04, -0.15, 0.01, 0.01]]},
+ {"i": 80,"j": 75, "score": 0.39, "iC": "DEKQNSGA", "jC": "EKSTAVLCY", "matrix": [[-0.06, -0.00, 0.27, -0.06, -0.09, -0.02, -0.05, 0.03, 0.01],[-0.11, -0.07, -0.09, -0.06, 0.22, 0.33, 0.05, 0.11, -0.29],[0.03, -0.03, 0.02, 0.07, -0.20, -0.02, 0.06, -0.05, 0.04],[-0.03, -0.02, -0.09, 0.05, 0.20, 0.15, -0.06, 0.04, -0.07],[0.02, -0.01, 0.02, 0.16, 0.10, -0.17, -0.04, -0.10, -0.07],[0.19, 0.15, -0.05, -0.05, -0.17, -0.20, 0.02, 0.18, 0.08],[-0.01, -0.01, 0.06, -0.05, 0.16, -0.08, -0.06, -0.05, 0.07],[0.02, 0.02, -0.13, -0.08, -0.18, 0.16, 0.19, -0.12, 0.12]]},
+ {"i": 80,"j": 76, "score": 1.15, "iC": "DEKQNSTA", "jC": "DEKRHNSPGA", "matrix": [[-0.40, -0.00, 0.16, 0.19, 0.24, -0.10, -0.04, -0.25, -0.08, 0.02],[-0.76, -0.16, 0.28, 0.42, 0.52, -0.40, 0.04, -0.28, 0.50, 0.17],[0.66, 0.07, -0.08, -0.04, -0.32, 0.07, -0.05, -0.08, -0.07, -0.12],[-0.23, 0.05, -0.02, -0.12, -0.01, 0.07, 0.09, -0.15, 0.02, 0.17],[0.21, -0.03, -0.07, -0.02, -0.18, 0.17, 0.12, -0.10, -0.05, -0.07],[0.24, -0.02, -0.10, -0.07, 0.01, 0.02, -0.16, 0.16, -0.16, -0.11],[0.09, -0.00, -0.04, -0.02, -0.03, 0.03, -0.12, 0.17, -0.06, 0.00],[0.05, -0.01, -0.11, -0.16, -0.15, 0.08, -0.03, 0.44, -0.00, 0.06]]},
+ {"i": 80,"j": 77, "score": 1.16, "iC": "DEKNSTGA", "jC": "DENSTG", "matrix": [[-0.71, -0.16, 0.25, 0.05, 0.16, 0.05],[-0.80, -0.01, 0.06, 0.45, 0.25, 0.28],[0.11, 0.03, -0.18, 0.04, -0.02, 0.04],[-0.07, -0.01, 0.02, 0.16, -0.10, -0.04],[0.62, -0.06, 0.05, -0.31, -0.15, -0.07],[0.55, 0.00, -0.03, -0.38, -0.19, -0.06],[0.17, -0.02, -0.04, -0.03, -0.02, -0.01],[0.22, 0.04, -0.05, 0.08, -0.03, -0.13]]},
+ {"i": 80,"j": 83, "score": 0.65, "iC": "DEKHQGA", "jC": "DEKRNTAL", "matrix": [[-0.32, -0.64, 0.27, 0.24, 0.07, 0.10, -0.07, 0.24],[-0.19, -0.28, 0.05, 0.27, -0.11, -0.01, -0.01, 0.05],[0.07, 0.27, -0.22, -0.14, -0.04, -0.05, 0.06, 0.02],[0.02, 0.16, 0.03, -0.03, -0.04, -0.01, -0.08, -0.02],[0.13, 0.28, -0.26, -0.26, 0.08, 0.03, -0.04, -0.03],[-0.05, -0.02, 0.11, -0.03, -0.06, -0.02, 0.15, -0.02],[0.26, 0.07, 0.00, -0.14, 0.17, -0.18, 0.15, -0.05]]},
+ {"i": 81,"j": 40, "score": 0.79, "iC": "SGAVLF", "jC": "AVIL", "matrix": [[-0.01, -0.14, 0.23, -0.08],[-0.02, -0.20, -0.16, 0.38],[-0.17, -0.46, 0.39, 0.24],[-0.04, 0.29, -0.14, -0.12],[0.11, 0.33, 0.01, -0.40],[0.07, 0.14, -0.32, 0.06]]},
+ {"i": 81,"j": 61, "score": 0.36, "iC": "GAVIF", "jC": "VIL", "matrix": [[0.31, -0.04, -0.18],[0.09, 0.27, -0.21],[-0.12, -0.16, 0.19],[-0.12, -0.11, 0.22],[-0.12, 0.11, -0.15]]},
+ {"i": 81,"j": 75, "score": 0.67, "iC": "GAVILMF", "jC": "AVILMF", "matrix": [[0.18, 0.27, -0.03, -0.08, -0.03, -0.16],[0.41, 0.37, -0.29, -0.37, -0.19, 0.01],[0.00, -0.38, -0.14, 0.41, 0.20, -0.06],[-0.20, -0.13, 0.21, 0.02, 0.03, -0.12],[-0.21, 0.10, 0.19, -0.05, -0.01, -0.02],[-0.05, -0.05, -0.02, -0.01, 0.01, 0.18],[-0.10, 0.00, 0.05, 0.02, -0.02, 0.18]]},
+ {"i": 81,"j": 82, "score": 0.68, "iC": "GAVIL", "jC": "DVILMF", "matrix": [[-0.01, -0.08, 0.29, 0.17, -0.03, -0.13],[-0.15, 0.38, 0.24, 0.39, 0.22, 0.06],[-0.02, -0.02, -0.18, 0.10, -0.07, 0.21],[0.03, -0.14, -0.12, -0.24, -0.01, -0.02],[0.19, -0.13, -0.31, -0.52, -0.06, -0.06]]},
+ {"i": 81,"j": 85, "score": 0.65, "iC": "GAVILF", "jC": "NGAVILCY", "matrix": [[-0.02, 0.03, 0.47, -0.10, -0.02, -0.09, -0.06, -0.05],[-0.17, 0.07, 0.51, 0.19, -0.07, -0.11, 0.30, -0.28],[0.06, 0.03, -0.16, -0.02, -0.03, -0.17, -0.07, 0.16],[0.10, -0.01, -0.04, -0.04, -0.06, -0.14, -0.15, 0.05],[-0.05, -0.15, -0.42, 0.02, 0.22, 0.39, -0.12, 0.03],[0.06, 0.04, -0.07, -0.06, -0.02, -0.18, 0.09, 0.05]]},
+ {"i": 81,"j": 103, "score": 0.61, "iC": "GAVL", "jC": "STGALF", "matrix": [[0.01, 0.03, 0.05, 0.34, -0.14, -0.20],[0.18, -0.16, 0.18, 0.39, -0.43, -0.12],[-0.02, -0.03, -0.06, -0.18, 0.04, 0.39],[-0.08, -0.07, -0.06, -0.29, 0.53, -0.16]]},
+ {"i": 82,"j": 81, "score": 0.68, "iC": "DVILMF", "jC": "GAVIL", "matrix": [[-0.01, -0.15, -0.02, 0.03, 0.19],[-0.08, 0.38, -0.02, -0.14, -0.13],[0.29, 0.24, -0.18, -0.12, -0.31],[0.17, 0.39, 0.10, -0.24, -0.52],[-0.03, 0.22, -0.07, -0.01, -0.06],[-0.13, 0.06, 0.21, -0.02, -0.06]]},
+ {"i": 82,"j": 106, "score": 0.49, "iC": "ERILMFY", "jC": "DEKRHSAILMY", "matrix": [[-0.05, -0.05, 0.16, 0.08, -0.02, 0.03, 0.01, 0.02, 0.01, -0.00, -0.11],[0.22, 0.15, -0.05, -0.17, -0.02, 0.00, -0.03, 0.01, -0.07, -0.06, -0.06],[-0.10, -0.15, -0.15, 0.12, 0.01, -0.08, -0.17, 0.18, 0.25, 0.01, 0.31],[-0.19, -0.06, 0.03, -0.02, 0.32, -0.17, 0.16, -0.14, -0.01, -0.21, 0.27],[-0.08, -0.09, -0.05, 0.05, 0.04, -0.03, -0.01, -0.05, 0.20, 0.09, -0.04],[0.01, 0.04, -0.11, 0.12, 0.01, 0.03, -0.02, -0.20, -0.10, -0.04, 0.25],[0.27, 0.05, 0.10, -0.07, -0.00, 0.08, -0.00, -0.06, -0.15, -0.06, -0.15]]},
+ {"i": 83,"j": 79, "score": 0.45, "iC": "DEKRQSAL", "jC": "DEKQPA", "matrix": [[-0.16, -0.27, 0.19, 0.44, -0.25, -0.04],[-0.10, -0.07, 0.14, -0.20, 0.07, 0.13],[0.12, 0.15, -0.01, -0.17, -0.02, -0.05],[0.15, 0.24, -0.07, 0.00, -0.06, 0.01],[-0.19, 0.11, -0.05, -0.02, 0.06, -0.01],[-0.11, 0.04, -0.09, -0.09, 0.08, -0.15],[0.24, 0.04, -0.11, -0.09, 0.23, 0.10],[0.24, -0.16, 0.02, 0.04, -0.01, -0.07]]},
+ {"i": 83,"j": 80, "score": 0.65, "iC": "DEKRNTAL", "jC": "DEKHQGA", "matrix": [[-0.32, -0.19, 0.07, 0.02, 0.13, -0.05, 0.26],[-0.64, -0.28, 0.27, 0.16, 0.28, -0.02, 0.07],[0.27, 0.05, -0.22, 0.03, -0.26, 0.11, 0.00],[0.24, 0.27, -0.14, -0.03, -0.26, -0.03, -0.14],[0.07, -0.11, -0.04, -0.04, 0.08, -0.06, 0.17],[0.10, -0.01, -0.05, -0.01, 0.03, -0.02, -0.18],[-0.07, -0.01, 0.06, -0.08, -0.04, 0.15, 0.15],[0.24, 0.05, 0.02, -0.02, -0.03, -0.02, -0.05]]},
+ {"i": 83,"j": 84, "score": 0.36, "iC": "DERSA", "jC": "EKRAILM", "matrix": [[-0.17, -0.21, 0.04, 0.19, 0.16, 0.02, 0.03],[-0.21, 0.42, 0.26, -0.11, 0.03, -0.06, 0.13],[0.09, -0.19, -0.04, -0.20, -0.01, 0.21, 0.08],[0.03, 0.04, 0.00, -0.17, 0.15, 0.04, -0.07],[-0.02, 0.05, -0.18, 0.23, -0.13, 0.29, -0.18]]},
+ {"i": 83,"j": 86, "score": 0.56, "iC": "DEKRNA", "jC": "DEKRHPGV", "matrix": [[-0.14, -0.23, 0.23, 0.24, 0.00, -0.05, -0.07, 0.07],[-0.22, -0.38, 0.57, 0.23, 0.15, -0.17, -0.15, -0.01],[-0.00, 0.21, -0.28, -0.19, -0.06, -0.00, 0.07, 0.06],[0.07, 0.25, -0.35, -0.21, 0.04, -0.02, 0.08, 0.22],[-0.12, -0.23, 0.18, 0.09, 0.03, 0.00, -0.06, -0.01],[0.09, -0.00, 0.02, -0.03, -0.04, 0.18, 0.08, -0.12]]},
+ {"i": 84,"j": 57, "score": 0.41, "iC": "EKRQSALMFY", "jC": "ERHTPVIL", "matrix": [[-0.08, -0.06, 0.03, 0.16, -0.01, -0.00, 0.02, -0.04],[-0.07, -0.15, -0.06, 0.16, 0.07, -0.18, -0.03, -0.04],[0.11, -0.13, -0.02, 0.00, 0.18, -0.01, -0.03, 0.16],[-0.10, -0.01, -0.07, 0.18, 0.02, -0.04, 0.04, 0.16],[-0.01, 0.18, 0.03, -0.05, -0.04, -0.11, 0.06, -0.23],[-0.02, 0.14, 0.18, -0.13, 0.07, -0.01, -0.16, -0.20],[-0.03, 0.43, 0.03, -0.31, -0.23, -0.06, -0.00, 0.05],[-0.11, 0.23, -0.07, -0.20, -0.04, -0.08, 0.01, -0.00],[-0.05, -0.22, -0.10, 0.07, 0.01, 0.18, 0.08, 0.06],[0.41, -0.30, 0.02, -0.05, -0.06, 0.06, -0.10, 0.02]]},
+ {"i": 84,"j": 59, "score": 0.40, "iC": "KRHNSTALMWY", "jC": "VILFW", "matrix": [[-0.05, -0.03, -0.08, 0.20, -0.01],[-0.00, -0.06, 0.17, -0.03, -0.03],[-0.16, 0.00, 0.06, 0.08, -0.02],[-0.07, -0.16, -0.06, -0.04, 0.02],[0.06, -0.19, 0.04, 0.01, 0.00],[0.15, -0.01, -0.05, -0.06, -0.02],[-0.21, -0.17, 0.01, 0.00, 0.29],[0.17, 0.27, -0.31, 0.01, -0.08],[-0.08, 0.20, 0.04, -0.05, -0.02],[0.23, -0.15, 0.12, -0.04, -0.03],[0.03, 0.23, 0.14, -0.09, -0.05]]},
+ {"i": 84,"j": 73, "score": 0.62, "iC": "EKRAVILFWY", "jC": "EKRHSTVILFY", "matrix": [[-0.12, -0.01, 0.06, -0.15, -0.02, 0.01, 0.21, 0.28, 0.03, -0.02, -0.06],[0.18, -0.16, -0.12, 0.06, -0.02, -0.11, 0.14, 0.06, 0.01, -0.04, -0.03],[0.40, -0.14, -0.23, -0.17, -0.02, -0.10, -0.04, 0.07, -0.15, 0.01, 0.07],[0.07, -0.01, 0.13, -0.20, -0.10, 0.32, 0.22, 0.15, 0.08, -0.18, -0.12],[-0.10, -0.00, 0.09, -0.08, 0.05, 0.20, 0.08, 0.09, -0.14, 0.00, -0.04],[-0.09, 0.03, -0.03, 0.19, 0.01, -0.04, -0.11, 0.03, -0.01, 0.06, 0.10],[0.12, 0.03, 0.09, 0.19, 0.19, -0.28, -0.43, -0.55, 0.04, 0.14, 0.18],[-0.11, 0.09, -0.05, 0.17, -0.03, -0.01, 0.04, -0.20, -0.06, 0.10, 0.11],[-0.00, 0.05, 0.03, 0.01, -0.01, -0.08, -0.01, -0.09, 0.16, -0.01, -0.00],[-0.13, 0.07, -0.06, -0.01, -0.02, 0.03, 0.21, 0.08, 0.00, -0.08, -0.01]]},
+ {"i": 84,"j": 75, "score": 1.43, "iC": "DEKHNSAVILMFWY", "jC": "RHAVILMCFY", "matrix": [[0.04, 0.03, -0.17, -0.19, 0.03, -0.01, -0.02, -0.06, -0.05, 0.28],[0.30, 0.06, -0.31, 0.14, -0.03, -0.03, -0.06, -0.01, -0.13, 0.04],[-0.02, -0.02, 0.13, 0.03, 0.00, -0.12, -0.04, 0.13, -0.23, 0.04],[0.00, 0.04, -0.03, -0.20, 0.07, -0.01, -0.01, -0.06, 0.13, 0.12],[-0.02, -0.02, -0.06, -0.16, 0.05, 0.04, -0.02, -0.01, 0.07, 0.13],[-0.01, 0.06, -0.14, -0.08, -0.05, -0.06, -0.00, -0.12, 0.19, 0.18],[-0.04, 0.15, -0.41, 0.22, -0.23, -0.18, -0.07, -0.07, 0.53, 0.34],[-0.01, -0.01, -0.22, 0.29, 0.02, 0.03, -0.02, 0.16, -0.12, -0.11],[-0.03, -0.04, 0.50, 0.04, 0.07, -0.12, -0.08, 0.17, -0.37, -0.17],[-0.10, -0.17, 0.63, 0.40, 0.29, 0.16, -0.07, 0.03, -0.85, -0.43],[-0.02, -0.03, 0.59, -0.20, 0.09, -0.04, -0.01, -0.00, -0.23, -0.10],[-0.03, 0.02, -0.12, -0.25, -0.11, 0.11, 0.12, -0.17, 0.48, -0.12],[-0.02, -0.02, -0.07, -0.11, 0.00, 0.07, 0.07, -0.01, 0.22, -0.05],[-0.02, -0.05, -0.15, -0.31, -0.10, 0.34, 0.20, -0.09, 0.37, -0.03]]},
+ {"i": 84,"j": 83, "score": 0.36, "iC": "EKRAILM", "jC": "DERSA", "matrix": [[-0.17, -0.21, 0.09, 0.03, -0.02],[-0.21, 0.42, -0.19, 0.04, 0.05],[0.04, 0.26, -0.04, 0.00, -0.18],[0.19, -0.11, -0.20, -0.17, 0.23],[0.16, 0.03, -0.01, 0.15, -0.13],[0.02, -0.06, 0.21, 0.04, 0.29],[0.03, 0.13, 0.08, -0.07, -0.18]]},
+ {"i": 84,"j": 85, "score": 0.61, "iC": "EKRHNSTAVILFWY", "jC": "NSPGAVLCFY", "matrix": [[0.01, -0.03, -0.02, 0.05, -0.01, -0.15, 0.11, -0.15, 0.00, 0.22],[-0.01, -0.13, -0.05, 0.00, -0.00, 0.07, -0.03, -0.13, 0.01, 0.35],[-0.01, -0.08, -0.02, 0.16, -0.17, -0.16, 0.06, -0.11, 0.19, 0.17],[-0.02, -0.03, -0.01, -0.04, -0.15, -0.04, 0.05, 0.21, 0.04, 0.06],[0.05, -0.02, 0.02, -0.03, -0.18, -0.06, 0.07, -0.04, 0.06, 0.01],[-0.03, -0.02, -0.00, -0.06, -0.22, 0.08, 0.23, 0.19, -0.02, -0.08],[-0.02, -0.04, -0.00, -0.05, -0.06, -0.04, 0.17, 0.00, -0.01, 0.02],[-0.06, -0.01, -0.09, 0.02, 0.14, 0.20, -0.01, 0.13, -0.15, -0.11],[-0.02, 0.17, -0.02, -0.02, 0.18, -0.04, -0.05, 0.00, -0.06, -0.08],[-0.02, 0.03, 0.00, 0.11, 0.40, -0.18, -0.25, -0.06, -0.06, -0.10],[-0.02, -0.00, 0.28, 0.08, 0.02, 0.20, -0.15, -0.05, -0.08, -0.32],[0.02, 0.04, -0.03, -0.06, 0.34, 0.09, -0.13, 0.08, -0.05, -0.02],[0.17, 0.03, -0.02, -0.05, -0.24, -0.07, 0.05, -0.05, 0.06, 0.06],[-0.09, 0.07, -0.01, -0.10, 0.04, 0.03, -0.12, 0.21, -0.14, -0.23]]},
+ {"i": 84,"j": 87, "score": 0.55, "iC": "EKRSAIFW", "jC": "DEKRQSG", "matrix": [[-0.27, -0.35, 0.65, 0.19, -0.09, -0.06, -0.12],[0.02, 0.34, -0.17, -0.13, -0.08, -0.03, 0.00],[-0.03, 0.20, -0.14, -0.09, 0.13, -0.03, -0.03],[0.04, 0.06, -0.20, -0.07, 0.04, -0.03, -0.17],[0.23, -0.23, -0.23, 0.03, -0.12, 0.08, 0.23],[-0.03, 0.09, 0.16, 0.10, 0.02, 0.01, -0.02],[-0.14, -0.06, 0.11, -0.12, 0.17, 0.17, -0.04],[-0.15, 0.13, 0.01, -0.03, 0.06, 0.02, -0.06]]},
+ {"i": 85,"j": 38, "score": 0.39, "iC": "SAVILCY", "jC": "DTPAVLMC", "matrix": [[0.02, 0.02, -0.12, -0.18, -0.03, -0.01, 0.04, -0.03],[-0.16, -0.18, -0.13, 0.08, -0.07, -0.01, 0.16, 0.28],[-0.04, -0.21, 0.31, 0.16, 0.00, 0.02, -0.03, -0.06],[0.03, -0.07, -0.07, -0.08, 0.07, 0.17, -0.03, -0.02],[0.00, -0.18, 0.16, 0.44, 0.10, -0.12, -0.08, -0.01],[-0.05, 0.07, -0.02, -0.06, -0.23, -0.03, -0.02, -0.04],[0.12, 0.15, -0.17, -0.06, 0.01, 0.02, -0.01, -0.03]]},
+ {"i": 85,"j": 59, "score": 0.55, "iC": "GALCF", "jC": "AVILF", "matrix": [[-0.01, -0.23, 0.21, 0.03, -0.05],[-0.06, -0.58, 0.37, 0.08, 0.23],[0.20, 0.30, -0.26, -0.10, -0.09],[-0.04, -0.16, 0.03, 0.17, -0.04],[-0.02, 0.32, -0.13, -0.11, 0.05]]},
+ {"i": 85,"j": 81, "score": 0.65, "iC": "NGAVILCY", "jC": "GAVILF", "matrix": [[-0.02, -0.17, 0.06, 0.10, -0.05, 0.06],[0.03, 0.07, 0.03, -0.01, -0.15, 0.04],[0.47, 0.51, -0.16, -0.04, -0.42, -0.07],[-0.10, 0.19, -0.02, -0.04, 0.02, -0.06],[-0.02, -0.07, -0.03, -0.06, 0.22, -0.02],[-0.09, -0.11, -0.17, -0.14, 0.39, -0.18],[-0.06, 0.30, -0.07, -0.15, -0.12, 0.09],[-0.05, -0.28, 0.16, 0.05, 0.03, 0.05]]},
+ {"i": 85,"j": 84, "score": 0.61, "iC": "NSPGAVLCFY", "jC": "EKRHNSTAVILFWY", "matrix": [[0.01, -0.01, -0.01, -0.02, 0.05, -0.03, -0.02, -0.06, -0.02, -0.02, -0.02, 0.02, 0.17, -0.09],[-0.03, -0.13, -0.08, -0.03, -0.02, -0.02, -0.04, -0.01, 0.17, 0.03, -0.00, 0.04, 0.03, 0.07],[-0.02, -0.05, -0.02, -0.01, 0.02, -0.00, -0.00, -0.09, -0.02, 0.00, 0.28, -0.03, -0.02, -0.01],[0.05, 0.00, 0.16, -0.04, -0.03, -0.06, -0.05, 0.02, -0.02, 0.11, 0.08, -0.06, -0.05, -0.10],[-0.01, -0.00, -0.17, -0.15, -0.18, -0.22, -0.06, 0.14, 0.18, 0.40, 0.02, 0.34, -0.24, 0.04],[-0.15, 0.07, -0.16, -0.04, -0.06, 0.08, -0.04, 0.20, -0.04, -0.18, 0.20, 0.09, -0.07, 0.03],[0.11, -0.03, 0.06, 0.05, 0.07, 0.23, 0.17, -0.01, -0.05, -0.25, -0.15, -0.13, 0.05, -0.12],[-0.15, -0.13, -0.11, 0.21, -0.04, 0.19, 0.00, 0.13, 0.00, -0.06, -0.05, 0.08, -0.05, 0.21],[0.00, 0.01, 0.19, 0.04, 0.06, -0.02, -0.01, -0.15, -0.06, -0.06, -0.08, -0.05, 0.06, -0.14],[0.22, 0.35, 0.17, 0.06, 0.01, -0.08, 0.02, -0.11, -0.08, -0.10, -0.32, -0.02, 0.06, -0.23]]},
+ {"i": 85,"j": 87, "score": 0.39, "iC": "SGAVCFY", "jC": "DEKRNPGA", "matrix": [[-0.19, -0.00, -0.05, 0.01, 0.03, -0.06, -0.12, -0.03],[-0.16, 0.15, 0.09, 0.21, -0.13, -0.04, -0.12, 0.09],[-0.27, 0.01, 0.26, 0.05, -0.11, -0.23, -0.21, 0.32],[0.23, 0.04, -0.14, -0.13, 0.03, 0.01, 0.23, -0.19],[0.15, -0.13, 0.03, -0.03, 0.16, 0.07, 0.12, -0.04],[0.09, -0.18, -0.04, -0.01, 0.20, 0.08, 0.01, -0.12],[0.24, -0.18, -0.02, 0.05, 0.16, -0.04, 0.03, 0.00]]},
+ {"i": 85,"j": 91, "score": 0.63, "iC": "ESGAVILCFY", "jC": "TPGAIL", "matrix": [[-0.02, -0.01, -0.01, -0.07, -0.05, 0.21],[0.07, 0.06, 0.01, -0.18, 0.13, -0.03],[-0.01, -0.03, -0.02, -0.23, -0.00, 0.12],[0.08, 0.19, -0.16, -0.14, 0.45, 0.01],[0.03, 0.02, -0.03, 0.38, -0.31, -0.19],[0.11, -0.08, 0.05, 0.21, -0.23, -0.26],[-0.18, -0.05, 0.14, 0.22, 0.06, -0.35],[0.02, -0.05, -0.06, -0.02, 0.17, -0.18],[-0.04, -0.00, 0.02, -0.02, 0.08, 0.20],[-0.05, -0.03, 0.02, -0.03, -0.15, 0.36]]},
+ {"i": 86,"j": 83, "score": 0.56, "iC": "DEKRHPGV", "jC": "DEKRNA", "matrix": [[-0.14, -0.22, -0.00, 0.07, -0.12, 0.09],[-0.23, -0.38, 0.21, 0.25, -0.23, -0.00],[0.23, 0.57, -0.28, -0.35, 0.18, 0.02],[0.24, 0.23, -0.19, -0.21, 0.09, -0.03],[0.00, 0.15, -0.06, 0.04, 0.03, -0.04],[-0.05, -0.17, -0.00, -0.02, 0.00, 0.18],[-0.07, -0.15, 0.07, 0.08, -0.06, 0.08],[0.07, -0.01, 0.06, 0.22, -0.01, -0.12]]},
+ {"i": 86,"j": 87, "score": 0.62, "iC": "DEKRNTPGAL", "jC": "DEKQNSTGA", "matrix": [[-0.16, -0.19, 0.03, -0.03, -0.01, 0.03, 0.11, 0.15, -0.03],[-0.29, -0.29, 0.30, -0.04, 0.02, 0.07, 0.13, 0.17, -0.12],[0.30, 0.10, -0.04, 0.04, 0.24, -0.13, 0.01, -0.06, 0.03],[-0.10, 0.10, -0.01, 0.16, -0.05, -0.06, 0.15, -0.18, -0.04],[-0.08, -0.05, 0.15, -0.03, -0.00, 0.16, -0.01, -0.02, 0.02],[0.02, 0.06, 0.04, -0.12, -0.15, 0.04, -0.02, -0.02, -0.01],[-0.00, 0.21, 0.11, -0.06, -0.04, -0.08, -0.12, -0.18, 0.13],[0.53, 0.16, -0.10, -0.14, 0.17, -0.14, -0.05, -0.38, -0.19],[-0.14, 0.08, -0.17, 0.21, 0.03, 0.09, -0.05, 0.25, 0.03],[-0.17, -0.13, -0.15, 0.01, -0.10, -0.01, -0.00, 0.01, 0.13]]},
+ {"i": 87,"j": 84, "score": 0.55, "iC": "DEKRQSG", "jC": "EKRSAIFW", "matrix": [[-0.27, 0.02, -0.03, 0.04, 0.23, -0.03, -0.14, -0.15],[-0.35, 0.34, 0.20, 0.06, -0.23, 0.09, -0.06, 0.13],[0.65, -0.17, -0.14, -0.20, -0.23, 0.16, 0.11, 0.01],[0.19, -0.13, -0.09, -0.07, 0.03, 0.10, -0.12, -0.03],[-0.09, -0.08, 0.13, 0.04, -0.12, 0.02, 0.17, 0.06],[-0.06, -0.03, -0.03, -0.03, 0.08, 0.01, 0.17, 0.02],[-0.12, 0.00, -0.03, -0.17, 0.23, -0.02, -0.04, -0.06]]},
+ {"i": 87,"j": 85, "score": 0.39, "iC": "DEKRNPGA", "jC": "SGAVCFY", "matrix": [[-0.19, -0.16, -0.27, 0.23, 0.15, 0.09, 0.24],[-0.00, 0.15, 0.01, 0.04, -0.13, -0.18, -0.18],[-0.05, 0.09, 0.26, -0.14, 0.03, -0.04, -0.02],[0.01, 0.21, 0.05, -0.13, -0.03, -0.01, 0.05],[0.03, -0.13, -0.11, 0.03, 0.16, 0.20, 0.16],[-0.06, -0.04, -0.23, 0.01, 0.07, 0.08, -0.04],[-0.12, -0.12, -0.21, 0.23, 0.12, 0.01, 0.03],[-0.03, 0.09, 0.32, -0.19, -0.04, -0.12, 0.00]]},
+ {"i": 87,"j": 86, "score": 0.62, "iC": "DEKQNSTGA", "jC": "DEKRNTPGAL", "matrix": [[-0.16, -0.29, 0.30, -0.10, -0.08, 0.02, -0.00, 0.53, -0.14, -0.17],[-0.19, -0.29, 0.10, 0.10, -0.05, 0.06, 0.21, 0.16, 0.08, -0.13],[0.03, 0.30, -0.04, -0.01, 0.15, 0.04, 0.11, -0.10, -0.17, -0.15],[-0.03, -0.04, 0.04, 0.16, -0.03, -0.12, -0.06, -0.14, 0.21, 0.01],[-0.01, 0.02, 0.24, -0.05, -0.00, -0.15, -0.04, 0.17, 0.03, -0.10],[0.03, 0.07, -0.13, -0.06, 0.16, 0.04, -0.08, -0.14, 0.09, -0.01],[0.11, 0.13, 0.01, 0.15, -0.01, -0.02, -0.12, -0.05, -0.05, -0.00],[0.15, 0.17, -0.06, -0.18, -0.02, -0.02, -0.18, -0.38, 0.25, 0.01],[-0.03, -0.12, 0.03, -0.04, 0.02, -0.01, 0.13, -0.19, 0.03, 0.13]]},
+ {"i": 88,"j": 38, "score": 0.70, "iC": "DERHSPAVILF", "jC": "HSTPAIL", "matrix": [[0.26, -0.06, 0.16, -0.34, -0.07, 0.11, -0.01],[0.32, 0.19, 0.01, -0.40, -0.00, 0.04, -0.07],[-0.03, -0.00, -0.13, -0.02, 0.03, 0.01, 0.15],[-0.01, -0.02, -0.04, -0.15, 0.16, 0.03, -0.01],[-0.11, 0.10, 0.03, 0.26, -0.14, -0.15, 0.01],[-0.04, -0.01, 0.11, -0.05, -0.17, 0.13, 0.08],[-0.07, -0.10, -0.23, 0.68, -0.21, -0.02, -0.06],[-0.03, -0.03, -0.23, 0.36, 0.01, -0.11, 0.06],[-0.04, -0.04, -0.20, -0.07, 0.27, -0.08, -0.00],[0.10, -0.05, -0.06, -0.18, 0.36, -0.02, -0.02],[-0.02, 0.06, -0.07, 0.20, -0.07, 0.03, -0.01]]},
+ {"i": 88,"j": 89, "score": 0.55, "iC": "DEKQGAVI", "jC": "DEKRNTPGA", "matrix": [[-0.16, -0.02, 0.26, -0.11, -0.07, -0.02, -0.06, 0.01, 0.07],[-0.34, -0.39, 0.16, 0.05, 0.00, 0.38, 0.07, -0.17, 0.20],[-0.15, 0.07, 0.02, 0.00, 0.04, 0.00, -0.03, 0.02, -0.04],[-0.12, -0.19, 0.07, 0.05, 0.04, -0.03, 0.00, 0.04, 0.01],[-0.06, 0.01, 0.19, 0.18, 0.04, -0.02, -0.20, -0.04, -0.05],[0.04, 0.11, -0.09, -0.04, -0.22, 0.09, 0.12, -0.20, 0.10],[0.35, 0.20, -0.04, -0.19, 0.07, -0.01, 0.20, -0.14, -0.03],[0.24, 0.28, -0.10, -0.07, 0.01, -0.10, -0.10, -0.11, -0.10]]},
+ {"i": 89,"j": 37, "score": 0.56, "iC": "DEKRTP", "jC": "KRHQNTGAVMC", "matrix": [[0.31, 0.17, 0.25, -0.07, -0.18, -0.08, -0.06, 0.21, -0.10, -0.04, -0.19],[0.31, -0.02, 0.21, -0.17, -0.16, 0.41, -0.24, -0.18, 0.29, -0.09, -0.15],[-0.31, -0.08, -0.28, 0.20, 0.29, -0.03, 0.04, 0.02, -0.03, 0.20, 0.03],[-0.30, -0.06, -0.01, 0.09, 0.13, 0.04, 0.21, -0.11, -0.02, -0.01, 0.12],[0.01, -0.03, 0.16, -0.05, 0.01, -0.02, -0.03, -0.07, -0.01, -0.02, 0.04],[0.09, 0.00, -0.09, -0.06, -0.09, -0.04, -0.02, 0.15, -0.02, -0.00, 0.14]]},
+ {"i": 89,"j": 38, "score": 0.38, "iC": "EKRSTPGA", "jC": "KHTPVI", "matrix": [[0.29, -0.05, 0.24, 0.08, -0.12, -0.26],[-0.14, -0.01, -0.14, -0.14, 0.18, 0.21],[-0.03, -0.10, -0.15, -0.13, 0.15, 0.19],[-0.05, 0.18, 0.00, 0.01, 0.01, 0.01],[-0.01, 0.11, 0.08, -0.19, -0.02, 0.00],[0.02, -0.03, -0.21, 0.26, -0.02, -0.05],[-0.04, -0.07, 0.35, 0.14, -0.06, 0.07],[0.07, -0.02, -0.14, 0.18, 0.02, -0.04]]},
+ {"i": 89,"j": 88, "score": 0.55, "iC": "DEKRNTPGA", "jC": "DEKQGAVI", "matrix": [[-0.16, -0.34, -0.15, -0.12, -0.06, 0.04, 0.35, 0.24],[-0.02, -0.39, 0.07, -0.19, 0.01, 0.11, 0.20, 0.28],[0.26, 0.16, 0.02, 0.07, 0.19, -0.09, -0.04, -0.10],[-0.11, 0.05, 0.00, 0.05, 0.18, -0.04, -0.19, -0.07],[-0.07, 0.00, 0.04, 0.04, 0.04, -0.22, 0.07, 0.01],[-0.02, 0.38, 0.00, -0.03, -0.02, 0.09, -0.01, -0.10],[-0.06, 0.07, -0.03, 0.00, -0.20, 0.12, 0.20, -0.10],[0.01, -0.17, 0.02, 0.04, -0.04, -0.20, -0.14, -0.11],[0.07, 0.20, -0.04, 0.01, -0.05, 0.10, -0.03, -0.10]]},
+ {"i": 89,"j": 91, "score": 0.38, "iC": "DEKQTGA", "jC": "TPVI", "matrix": [[-0.29, -0.11, 0.37, 0.22],[-0.17, -0.17, 0.26, 0.32],[0.02, -0.01, -0.21, 0.02],[-0.06, -0.01, -0.17, 0.04],[-0.04, -0.01, -0.06, -0.16],[0.17, -0.03, 0.26, -0.07],[0.15, 0.09, -0.09, -0.17]]},
+ {"i": 90,"j": 2, "score": 1.10, "iC": "DEKRHTVL", "jC": "EKNSTAVIC", "matrix": [[-0.09, 0.37, 0.21, -0.37, -0.09, -0.12, -0.25, 0.16, 0.01],[-0.20, 0.21, 0.13, 0.93, 0.49, -0.34, -0.08, -0.38, -0.20],[0.08, -0.23, -0.15, -0.06, -0.22, -0.04, -0.06, 0.44, 0.09],[0.37, -0.17, -0.23, -0.12, 0.03, 0.04, 0.06, -0.05, 0.14],[0.00, -0.01, -0.01, 0.26, 0.04, -0.11, -0.08, 0.02, -0.02],[0.00, -0.01, 0.00, -0.23, -0.22, 0.35, 0.21, -0.03, -0.01],[-0.02, 0.01, -0.01, -0.05, -0.06, 0.02, 0.16, 0.00, -0.02],[0.01, -0.02, -0.06, -0.08, -0.17, 0.24, 0.03, -0.02, 0.04]]},
+ {"i": 90,"j": 37, "score": 0.93, "iC": "DEKRHQTAVL", "jC": "KRHNSTAVCY", "matrix": [[0.54, 0.09, -0.06, -0.27, -0.02, 0.08, 0.05, -0.03, -0.03, -0.00],[0.98, 0.21, 0.27, 0.01, -0.21, -0.19, -0.19, -0.06, -0.24, -0.13],[-0.34, -0.13, -0.07, 0.15, 0.02, -0.02, 0.01, 0.02, 0.15, 0.15],[-0.38, -0.14, -0.19, -0.07, 0.09, 0.03, 0.21, -0.06, 0.11, -0.04],[-0.13, 0.03, -0.16, 0.16, 0.01, -0.02, -0.01, -0.02, -0.03, -0.00],[-0.18, -0.04, 0.03, 0.00, 0.04, -0.03, 0.03, -0.04, -0.04, 0.08],[-0.22, -0.07, 0.10, 0.01, 0.03, 0.03, -0.13, 0.16, 0.05, -0.01],[0.11, -0.01, -0.21, -0.07, -0.00, -0.05, -0.01, -0.01, 0.11, 0.02],[-0.09, -0.06, 0.17, -0.00, -0.06, -0.02, 0.09, -0.00, -0.02, 0.01],[-0.11, -0.00, 0.27, -0.07, -0.01, -0.04, -0.00, -0.01, -0.07, 0.02]]},
+ {"i": 90,"j": 92, "score": 0.54, "iC": "DEKRQTV", "jC": "SVIMCFWY", "matrix": [[-0.07, -0.01, -0.02, -0.03, -0.08, -0.23, 0.12, 0.30],[-0.33, 0.23, 0.18, 0.28, 0.23, -0.01, -0.01, -0.56],[-0.01, -0.05, -0.05, -0.07, 0.04, 0.49, -0.11, -0.19],[0.16, -0.06, 0.04, -0.06, -0.00, 0.07, -0.12, 0.04],[0.00, -0.01, -0.01, -0.01, -0.08, 0.16, -0.02, -0.07],[0.02, -0.03, -0.05, -0.01, -0.07, -0.17, 0.24, 0.15],[0.06, -0.01, -0.03, -0.05, 0.01, -0.16, -0.06, 0.15]]},
+ {"i": 90,"j": 109, "score": 0.75, "iC": "DEKRN", "jC": "EKRVY", "matrix": [[-0.11, -0.01, -0.07, 0.19, -0.09],[-0.55, 0.72, 0.56, 0.02, -0.19],[0.45, -0.34, -0.48, -0.10, 0.07],[-0.05, -0.23, 0.00, -0.02, 0.06],[0.08, -0.03, 0.06, 0.16, 0.01]]},
+ {"i": 90,"j": 111, "score": 0.39, "iC": "EKRST", "jC": "ELFY", "matrix": [[-0.37, -0.09, -0.19, 0.57],[0.07, 0.22, -0.09, -0.19],[0.02, 0.39, -0.14, -0.23],[0.03, -0.06, 0.15, -0.01],[0.15, -0.21, 0.00, -0.06]]},
+ {"i": 91,"j": 1, "score": 0.37, "iC": "SAVILC", "jC": "IL", "matrix": [[-0.16, 0.16],[-0.14, 0.34],[0.01, -0.27],[0.16, -0.34],[0.33, -0.17],[0.01, -0.15]]},
+ {"i": 91,"j": 40, "score": 1.09, "iC": "TPAVILY", "jC": "VIL", "matrix": [[0.33, -0.22, -0.09],[-0.13, 0.20, -0.09],[-0.35, 0.53, -0.20],[0.27, -0.08, -0.09],[0.24, -0.31, 0.04],[0.02, -0.79, 0.76],[-0.21, 0.26, -0.07]]},
+ {"i": 91,"j": 85, "score": 0.63, "iC": "TPGAIL", "jC": "ESGAVILCFY", "matrix": [[-0.02, 0.07, -0.01, 0.08, 0.03, 0.11, -0.18, 0.02, -0.04, -0.05],[-0.01, 0.06, -0.03, 0.19, 0.02, -0.08, -0.05, -0.05, -0.00, -0.03],[-0.01, 0.01, -0.02, -0.16, -0.03, 0.05, 0.14, -0.06, 0.02, 0.02],[-0.07, -0.18, -0.23, -0.14, 0.38, 0.21, 0.22, -0.02, -0.02, -0.03],[-0.05, 0.13, -0.00, 0.45, -0.31, -0.23, 0.06, 0.17, 0.08, -0.15],[0.21, -0.03, 0.12, 0.01, -0.19, -0.26, -0.35, -0.18, 0.20, 0.36]]},
+ {"i": 91,"j": 89, "score": 0.38, "iC": "TPVI", "jC": "DEKQTGA", "matrix": [[-0.29, -0.17, 0.02, -0.06, -0.04, 0.17, 0.15],[-0.11, -0.17, -0.01, -0.01, -0.01, -0.03, 0.09],[0.37, 0.26, -0.21, -0.17, -0.06, 0.26, -0.09],[0.22, 0.32, 0.02, 0.04, -0.16, -0.07, -0.17]]},
+ {"i": 92,"j": 2, "score": 0.71, "iC": "AMFWY", "jC": "KRHQNSTGAVIF", "matrix": [[0.02, -0.04, -0.03, -0.02, -0.08, -0.09, -0.06, -0.04, -0.13, 0.07, 0.05, 0.16],[-0.08, -0.00, -0.03, 0.03, -0.18, 0.24, 0.11, -0.01, 0.20, -0.05, -0.10, -0.05],[-0.09, -0.28, 0.03, 0.23, -0.02, 0.20, 0.16, -0.31, 0.04, -0.12, 0.05, -0.04],[0.27, 0.21, 0.15, -0.10, 0.37, -0.33, -0.44, 0.55, -0.05, -0.23, -0.17, -0.01],[0.03, -0.06, 0.02, -0.14, 0.08, -0.09, -0.20, 0.02, -0.09, 0.05, 0.36, -0.02]]},
+ {"i": 92,"j": 4, "score": 0.95, "iC": "HSVMCFW", "jC": "VIL", "matrix": [[0.21, -0.18, -0.02],[0.24, -0.27, 0.01],[-0.08, -0.11, 0.16],[0.15, 0.23, -0.25],[0.38, -0.42, -0.05],[-0.52, 0.38, 0.24],[-0.54, 0.61, -0.03]]},
+ {"i": 92,"j": 33, "score": 0.50, "iC": "AVFWY", "jC": "EKHTVILMY", "matrix": [[0.04, -0.01, -0.01, -0.15, -0.04, 0.02, 0.01, 0.19, -0.02],[-0.00, 0.01, -0.03, -0.17, -0.04, -0.03, -0.14, 0.01, 0.31],[-0.19, 0.02, -0.25, 0.56, 0.05, 0.22, 0.14, -0.10, -0.15],[-0.15, 0.04, 0.10, 0.01, -0.23, -0.25, 0.19, 0.33, -0.08],[0.22, -0.16, 0.09, 0.18, -0.04, 0.04, 0.02, -0.27, -0.04]]},
+ {"i": 92,"j": 37, "score": 1.40, "iC": "SAVIMCFWY", "jC": "KRHQNSTGAVCY", "matrix": [[-0.15, -0.05, -0.15, -0.01, -0.04, 0.11, 0.24, -0.05, 0.19, -0.01, -0.04, 0.01],[0.41, 0.08, -0.29, -0.04, -0.02, -0.01, -0.06, -0.09, -0.08, -0.01, -0.01, -0.02],[0.54, 0.20, -0.32, -0.05, -0.08, -0.02, -0.02, -0.04, -0.06, -0.01, -0.04, -0.02],[0.33, -0.03, -0.28, 0.16, -0.01, -0.03, -0.03, -0.05, -0.04, -0.01, 0.08, 0.00],[0.72, 0.18, -0.10, -0.06, -0.06, -0.16, -0.00, -0.20, -0.10, -0.02, -0.11, -0.06],[0.31, 0.08, -0.06, -0.02, -0.02, -0.08, -0.05, -0.11, -0.07, -0.01, -0.01, -0.02],[-1.04, -0.25, 0.67, -0.01, 0.18, 0.03, -0.12, 0.08, 0.14, -0.06, -0.02, 0.20],[-0.60, -0.09, 0.01, -0.08, -0.13, 0.12, 0.00, 0.18, 0.11, 0.18, 0.28, 0.01],[-0.33, -0.13, 0.29, 0.07, 0.15, 0.01, 0.00, 0.25, -0.03, -0.08, -0.11, -0.08]]},
+ {"i": 92,"j": 90, "score": 0.54, "iC": "SVIMCFWY", "jC": "DEKRQTV", "matrix": [[-0.07, -0.33, -0.01, 0.16, 0.00, 0.02, 0.06],[-0.01, 0.23, -0.05, -0.06, -0.01, -0.03, -0.01],[-0.02, 0.18, -0.05, 0.04, -0.01, -0.05, -0.03],[-0.03, 0.28, -0.07, -0.06, -0.01, -0.01, -0.05],[-0.08, 0.23, 0.04, -0.00, -0.08, -0.07, 0.01],[-0.23, -0.01, 0.49, 0.07, 0.16, -0.17, -0.16],[0.12, -0.01, -0.11, -0.12, -0.02, 0.24, -0.06],[0.30, -0.56, -0.19, 0.04, -0.07, 0.15, 0.15]]},
+ {"i": 92,"j": 94, "score": 0.41, "iC": "HAVIMCF", "jC": "GAIMF", "matrix": [[0.20, -0.03, -0.08, -0.02, -0.01],[-0.04, -0.11, 0.20, -0.06, -0.03],[0.00, 0.18, -0.20, 0.09, 0.05],[0.00, 0.11, -0.49, 0.37, 0.19],[-0.06, -0.15, 0.12, 0.04, -0.10],[-0.03, -0.11, 0.17, -0.12, -0.03],[-0.03, 0.07, 0.17, -0.21, 0.01]]},
+ {"i": 93,"j": 99, "score": 0.50, "iC": "VIL", "jC": "IL", "matrix": [[0.15, -0.22],[0.22, -0.09],[-0.47, 0.54]]},
+ {"i": 93,"j": 103, "score": 0.96, "iC": "GVILF", "jC": "STGAILMF", "matrix": [[-0.02, -0.04, -0.02, -0.16, -0.01, 0.20, 0.13, -0.06],[-0.08, 0.06, -0.75, 0.21, 0.07, 0.27, 0.10, 0.16],[0.28, 0.27, 0.10, 0.14, -0.21, -0.65, -0.23, 0.18],[-0.06, -0.21, 0.55, -0.21, -0.02, 0.11, 0.01, -0.08],[-0.05, -0.02, -0.01, 0.22, -0.01, -0.07, -0.05, -0.09]]},
+ {"i": 94,"j": 30, "score": 1.14, "iC": "ILF", "jC": "VLMFY", "matrix": [[-0.26, -0.23, -0.12, 0.75, -0.18],[-0.04, 0.36, 0.01, -0.31, 0.06],[0.50, 0.18, 0.17, -0.78, -0.06]]},
+ {"i": 94,"j": 39, "score": 0.90, "iC": "STGAVILMCF", "jC": "VILM", "matrix": [[-0.04, -0.05, 0.17, -0.04],[-0.03, 0.26, -0.12, -0.08],[-0.13, -0.07, 0.33, -0.08],[0.06, -0.26, 0.17, 0.16],[-0.30, 0.05, -0.06, 0.38],[0.35, 0.29, -0.50, -0.05],[0.21, -0.12, -0.16, -0.06],[0.42, -0.36, 0.00, -0.10],[-0.12, 0.18, -0.14, -0.06],[-0.34, 0.06, 0.38, -0.08]]},
+ {"i": 94,"j": 41, "score": 0.38, "iC": "SIC", "jC": "MF", "matrix": [[-0.15, 0.07],[0.44, -0.18],[-0.28, 0.07]]},
+ {"i": 94,"j": 49, "score": 0.38, "iC": "TVILM", "jC": "VILMF", "matrix": [[0.04, 0.01, -0.01, -0.01, -0.15],[0.18, -0.07, -0.30, 0.08, 0.07],[-0.27, -0.06, 0.17, 0.20, 0.27],[-0.05, -0.32, 0.11, 0.00, 0.15],[-0.02, 0.03, 0.23, -0.08, -0.23]]},
+ {"i": 94,"j": 58, "score": 0.81, "iC": "AVIMC", "jC": "HNSTVI", "matrix": [[-0.07, -0.55, -0.13, 0.31, 0.22, 0.19],[0.03, -0.17, 0.00, 0.31, -0.06, -0.07],[0.27, 0.46, 0.31, -0.50, -0.20, -0.20],[-0.07, 0.24, -0.05, -0.11, -0.02, -0.02],[-0.07, -0.19, -0.07, 0.14, 0.11, 0.06]]},
+ {"i": 94,"j": 92, "score": 0.41, "iC": "GAIMF", "jC": "HAVIMCF", "matrix": [[0.20, -0.04, 0.00, 0.00, -0.06, -0.03, -0.03],[-0.03, -0.11, 0.18, 0.11, -0.15, -0.11, 0.07],[-0.08, 0.20, -0.20, -0.49, 0.12, 0.17, 0.17],[-0.02, -0.06, 0.09, 0.37, 0.04, -0.12, -0.21],[-0.01, -0.03, 0.05, 0.19, -0.10, -0.03, 0.01]]},
+ {"i": 97,"j": 98, "score": 0.61, "iC": "EGAV", "jC": "DEKRQSTGV", "matrix": [[-0.17, -0.53, 0.30, 0.12, 0.21, 0.21, 0.10, -0.05, -0.06],[0.06, 0.62, 0.03, -0.15, 0.08, -0.41, -0.19, -0.27, 0.19],[0.04, 0.17, -0.14, -0.17, 0.12, -0.13, 0.15, 0.16, -0.05],[0.00, -0.06, -0.05, 0.03, -0.06, 0.15, 0.01, 0.04, -0.01]]},
+ {"i": 97,"j": 101, "score": 0.92, "iC": "EKRQSGA", "jC": "DEKRQNSA", "matrix": [[-0.20, -0.58, 0.23, 0.87, -0.25, -0.08, -0.07, -0.15],[0.10, 0.35, -0.22, -0.08, 0.05, -0.06, -0.05, -0.03],[0.13, 0.22, -0.18, -0.11, 0.05, -0.02, 0.03, -0.06],[0.08, 0.47, -0.20, -0.17, 0.08, -0.06, -0.02, -0.10],[0.02, 0.05, -0.01, -0.32, 0.06, 0.22, -0.06, 0.03],[-0.03, -0.24, 0.03, 0.02, -0.06, -0.02, 0.18, 0.24],[-0.05, -0.05, 0.02, -0.18, 0.10, 0.07, 0.07, 0.24]]},
+ {"i": 97,"j": 123, "score": 0.77, "iC": "DEKRSG", "jC": "KRSTAV", "matrix": [[-0.02, 0.01, 0.13, -0.16, 0.07, -0.06],[0.25, 0.24, -0.07, -0.24, 0.38, -0.40],[-0.03, -0.04, -0.04, -0.05, -0.09, 0.17],[-0.02, -0.02, -0.02, -0.07, -0.10, 0.18],[-0.01, -0.00, 0.32, -0.04, -0.15, -0.20],[-0.17, -0.31, -0.17, 0.55, -0.41, 0.34]]},
+ {"i": 98,"j": 44, "score": 0.52, "iC": "DEKRQ", "jC": "KRNVL", "matrix": [[0.25, -0.02, -0.07, -0.01, -0.05],[0.74, 0.29, -0.30, -0.20, -0.23],[-0.24, -0.10, 0.05, 0.08, 0.09],[-0.28, 0.05, 0.05, -0.01, 0.07],[-0.12, -0.25, 0.13, 0.07, 0.08]]},
+ {"i": 98,"j": 63, "score": 1.14, "iC": "DEKRQSTGAM", "jC": "RHSTG", "matrix": [[0.47, -0.10, -0.17, 0.02, -0.03],[1.07, -0.09, -0.27, -0.21, -0.20],[-0.38, -0.02, 0.26, 0.16, 0.07],[-0.64, -0.03, 0.31, 0.15, 0.14],[0.33, 0.08, -0.11, -0.25, -0.05],[-0.30, 0.02, -0.05, -0.08, 0.15],[-0.28, -0.03, 0.02, 0.11, -0.01],[-0.21, -0.02, 0.19, -0.03, -0.00],[0.04, 0.15, -0.11, 0.03, -0.01],[-0.27, -0.07, -0.05, 0.02, 0.01]]},
+ {"i": 98,"j": 97, "score": 0.61, "iC": "DEKRQSTGV", "jC": "EGAV", "matrix": [[-0.17, 0.06, 0.04, 0.00],[-0.53, 0.62, 0.17, -0.06],[0.30, 0.03, -0.14, -0.05],[0.12, -0.15, -0.17, 0.03],[0.21, 0.08, 0.12, -0.06],[0.21, -0.41, -0.13, 0.15],[0.10, -0.19, 0.15, 0.01],[-0.05, -0.27, 0.16, 0.04],[-0.06, 0.19, -0.05, -0.01]]},
+ {"i": 98,"j": 101, "score": 1.18, "iC": "DEKRQST", "jC": "DEKRQNTA", "matrix": [[-0.06, -0.37, -0.01, 0.51, -0.10, -0.01, -0.02, -0.09],[-0.28, -0.95, 0.49, 0.80, -0.20, 0.17, -0.11, 0.01],[-0.07, 0.59, -0.31, -0.30, -0.02, -0.10, 0.01, -0.02],[0.00, 0.29, -0.14, -0.24, 0.04, -0.10, 0.00, 0.12],[0.00, 0.00, -0.06, -0.30, -0.15, 0.10, 0.24, 0.27],[-0.03, 0.14, 0.04, -0.04, 0.13, -0.12, -0.11, 0.17],[0.12, 0.25, -0.00, -0.10, 0.09, 0.07, -0.01, -0.30]]},
+ {"i": 98,"j": 102, "score": 1.11, "iC": "DEKRQNSGAVM", "jC": "DEQSAL", "matrix": [[-0.08, -0.35, 0.45, -0.03, -0.16, 0.18],[-0.36, -0.66, 0.21, -0.10, -0.09, 0.66],[0.11, 0.18, -0.23, 0.19, -0.08, -0.03],[0.38, 0.47, -0.21, -0.11, -0.15, -0.15],[0.06, 0.08, -0.20, -0.09, 0.10, 0.02],[-0.01, -0.20, 0.73, -0.01, -0.18, -0.13],[-0.03, 0.07, 0.19, -0.07, 0.17, -0.29],[-0.00, 0.27, -0.26, 0.11, -0.01, -0.09],[0.00, 0.02, -0.40, 0.04, 0.19, 0.04],[0.07, 0.00, -0.16, 0.05, 0.04, -0.03],[-0.04, 0.11, -0.24, -0.02, 0.03, 0.06]]},
+ {"i": 99,"j": 61, "score": 0.95, "iC": "VILM", "jC": "VILM", "matrix": [[-0.76, 0.04, 0.68, 0.16],[-0.00, 0.26, -0.38, -0.02],[0.46, -0.17, -0.22, -0.12],[0.30, -0.17, -0.13, 0.04]]},
+ {"i": 99,"j": 93, "score": 0.50, "iC": "IL", "jC": "VIL", "matrix": [[0.15, 0.22, -0.47],[-0.22, -0.09, 0.54]]},
+ {"i": 99,"j": 102, "score": 0.43, "iC": "VIL", "jC": "DEQSTL", "matrix": [[0.20, 0.14, 0.02, 0.05, 0.06, -0.22],[-0.25, -0.23, 0.25, -0.17, -0.19, 0.47],[0.09, 0.10, -0.13, 0.16, 0.06, -0.31]]},
+ {"i": 100,"j": 3, "score": 0.50, "iC": "IFY", "jC": "SILMFY", "matrix": [[-0.01, 0.17, -0.09, -0.04, -0.05, -0.01],[-0.13, -0.24, -0.00, -0.20, 0.42, 0.20],[0.16, -0.08, 0.19, 0.37, -0.34, -0.18]]},
+ {"i": 101,"j": 97, "score": 0.92, "iC": "DEKRQNSA", "jC": "EKRQSGA", "matrix": [[-0.20, 0.10, 0.13, 0.08, 0.02, -0.03, -0.05],[-0.58, 0.35, 0.22, 0.47, 0.05, -0.24, -0.05],[0.23, -0.22, -0.18, -0.20, -0.01, 0.03, 0.02],[0.87, -0.08, -0.11, -0.17, -0.32, 0.02, -0.18],[-0.25, 0.05, 0.05, 0.08, 0.06, -0.06, 0.10],[-0.08, -0.06, -0.02, -0.06, 0.22, -0.02, 0.07],[-0.07, -0.05, 0.03, -0.02, -0.06, 0.18, 0.07],[-0.15, -0.03, -0.06, -0.10, 0.03, 0.24, 0.24]]},
+ {"i": 101,"j": 98, "score": 1.18, "iC": "DEKRQNTA", "jC": "DEKRQST", "matrix": [[-0.06, -0.28, -0.07, 0.00, 0.00, -0.03, 0.12],[-0.37, -0.95, 0.59, 0.29, 0.00, 0.14, 0.25],[-0.01, 0.49, -0.31, -0.14, -0.06, 0.04, -0.00],[0.51, 0.80, -0.30, -0.24, -0.30, -0.04, -0.10],[-0.10, -0.20, -0.02, 0.04, -0.15, 0.13, 0.09],[-0.01, 0.17, -0.10, -0.10, 0.10, -0.12, 0.07],[-0.02, -0.11, 0.01, 0.00, 0.24, -0.11, -0.01],[-0.09, 0.01, -0.02, 0.12, 0.27, 0.17, -0.30]]},
+ {"i": 101,"j": 102, "score": 0.43, "iC": "DEKRQNSA", "jC": "DEQAVLM", "matrix": [[-0.03, -0.19, -0.12, 0.02, 0.19, 0.07, 0.06],[-0.22, -0.43, 0.27, 0.17, 0.01, -0.11, 0.02],[0.12, 0.20, -0.23, -0.04, 0.02, -0.25, 0.16],[0.17, 0.22, 0.11, -0.25, -0.01, -0.06, -0.00],[-0.06, 0.03, 0.20, 0.02, 0.05, -0.13, -0.11],[-0.04, -0.11, -0.27, 0.01, -0.00, 0.18, -0.07],[-0.01, -0.14, -0.02, -0.02, -0.01, 0.20, -0.02],[0.05, 0.22, 0.01, -0.02, -0.16, 0.09, -0.04]]},
+ {"i": 101,"j": 126, "score": 0.40, "iC": "DKNSA", "jC": "EKP", "matrix": [[-0.05, 0.16, -0.38],[0.29, -0.11, -0.03],[-0.02, 0.08, -0.22],[-0.04, -0.02, 0.22],[-0.17, -0.05, 0.22]]},
+ {"i": 102,"j": 61, "score": 0.38, "iC": "HQSALMY", "jC": "VILMF", "matrix": [[0.06, 0.03, -0.19, 0.07, 0.01],[0.18, 0.06, 0.02, -0.14, -0.10],[0.16, 0.09, -0.21, 0.02, -0.01],[0.17, 0.08, -0.15, -0.01, -0.05],[-0.38, -0.29, 0.25, 0.17, 0.19],[-0.20, 0.02, 0.15, 0.02, -0.01],[-0.00, 0.11, -0.16, 0.01, 0.02]]},
+ {"i": 102,"j": 78, "score": 0.70, "iC": "DEQSTAILMY", "jC": "KPVILFW", "matrix": [[0.01, 0.02, -0.04, -0.04, 0.03, -0.05, 0.18],[-0.08, -0.16, -0.05, 0.06, 0.42, 0.00, -0.01],[-0.09, -0.38, 0.13, 0.44, 0.52, -0.10, -0.15],[-0.05, -0.02, 0.15, 0.08, -0.20, -0.09, -0.01],[0.00, 0.09, -0.07, -0.04, -0.18, 0.04, 0.01],[-0.06, 0.19, 0.20, 0.17, -0.01, -0.25, -0.11],[-0.00, 0.20, -0.00, -0.18, -0.03, -0.01, 0.01],[0.18, -0.04, -0.10, -0.24, -0.08, 0.19, 0.10],[0.21, -0.00, -0.18, -0.21, -0.07, 0.12, -0.02],[-0.01, 0.17, 0.01, 0.04, -0.14, 0.00, -0.01]]},
+ {"i": 102,"j": 98, "score": 1.11, "iC": "DEQSAL", "jC": "DEKRQNSGAVM", "matrix": [[-0.08, -0.36, 0.11, 0.38, 0.06, -0.01, -0.03, -0.00, 0.00, 0.07, -0.04],[-0.35, -0.66, 0.18, 0.47, 0.08, -0.20, 0.07, 0.27, 0.02, 0.00, 0.11],[0.45, 0.21, -0.23, -0.21, -0.20, 0.73, 0.19, -0.26, -0.40, -0.16, -0.24],[-0.03, -0.10, 0.19, -0.11, -0.09, -0.01, -0.07, 0.11, 0.04, 0.05, -0.02],[-0.16, -0.09, -0.08, -0.15, 0.10, -0.18, 0.17, -0.01, 0.19, 0.04, 0.03],[0.18, 0.66, -0.03, -0.15, 0.02, -0.13, -0.29, -0.09, 0.04, -0.03, 0.06]]},
+ {"i": 102,"j": 99, "score": 0.43, "iC": "DEQSTL", "jC": "VIL", "matrix": [[0.20, -0.25, 0.09],[0.14, -0.23, 0.10],[0.02, 0.25, -0.13],[0.05, -0.17, 0.16],[0.06, -0.19, 0.06],[-0.22, 0.47, -0.31]]},
+ {"i": 102,"j": 101, "score": 0.43, "iC": "DEQAVLM", "jC": "DEKRQNSA", "matrix": [[-0.03, -0.22, 0.12, 0.17, -0.06, -0.04, -0.01, 0.05],[-0.19, -0.43, 0.20, 0.22, 0.03, -0.11, -0.14, 0.22],[-0.12, 0.27, -0.23, 0.11, 0.20, -0.27, -0.02, 0.01],[0.02, 0.17, -0.04, -0.25, 0.02, 0.01, -0.02, -0.02],[0.19, 0.01, 0.02, -0.01, 0.05, -0.00, -0.01, -0.16],[0.07, -0.11, -0.25, -0.06, -0.13, 0.18, 0.20, 0.09],[0.06, 0.02, 0.16, -0.00, -0.11, -0.07, -0.02, -0.04]]},
+ {"i": 102,"j": 103, "score": 0.43, "iC": "EKQSAILY", "jC": "STGAVLMFW", "matrix": [[0.09, 0.10, 0.07, 0.10, 0.15, -0.31, 0.07, -0.30, -0.00],[-0.00, -0.05, 0.03, 0.02, -0.02, 0.07, 0.03, -0.16, 0.03],[0.09, 0.18, -0.28, -0.17, 0.09, 0.04, 0.04, -0.26, 0.16],[0.06, -0.02, -0.07, -0.12, 0.15, 0.05, 0.06, -0.11, -0.02],[-0.18, 0.10, -0.10, 0.06, 0.01, 0.20, 0.02, 0.08, -0.06],[-0.03, -0.04, 0.06, -0.07, -0.04, -0.08, -0.05, 0.29, -0.01],[-0.08, -0.17, 0.24, 0.11, -0.16, 0.07, -0.20, 0.31, -0.09],[-0.01, -0.04, 0.00, -0.00, -0.02, -0.07, -0.04, 0.18, 0.00]]},
+ {"i": 103,"j": 3, "score": 0.75, "iC": "STGAVILMCF", "jC": "HSGAVILMFY", "matrix": [[0.08, 0.03, 0.01, -0.05, 0.04, 0.11, 0.15, -0.23, -0.12, -0.03],[0.34, 0.16, -0.06, 0.03, -0.01, -0.08, 0.14, -0.58, -0.03, -0.07],[-0.03, -0.02, -0.03, -0.11, -0.05, 0.06, -0.13, 0.38, -0.03, -0.01],[-0.18, -0.03, -0.12, 0.08, 0.18, 0.30, 0.17, -0.18, -0.17, -0.13],[-0.01, -0.04, -0.00, -0.07, -0.01, 0.15, 0.19, -0.05, -0.15, -0.04],[-0.01, 0.02, 0.00, -0.06, 0.04, -0.02, 0.19, -0.03, -0.11, -0.02],[-0.03, -0.01, -0.00, 0.21, -0.13, -0.20, -0.37, 0.07, 0.36, 0.25],[-0.03, -0.05, 0.01, 0.17, 0.04, -0.18, -0.16, 0.11, 0.13, -0.01],[-0.02, -0.02, -0.01, -0.08, 0.03, 0.04, -0.20, 0.31, -0.06, -0.01],[-0.08, 0.02, 0.22, -0.08, -0.12, -0.05, -0.13, 0.11, 0.15, 0.07]]},
+ {"i": 103,"j": 40, "score": 0.40, "iC": "STGVLF", "jC": "VIL", "matrix": [[-0.04, 0.16, -0.11],[-0.13, -0.24, 0.32],[-0.19, 0.18, 0.01],[0.08, 0.05, -0.17],[-0.05, -0.19, 0.30],[0.30, 0.14, -0.34]]},
+ {"i": 103,"j": 61, "score": 0.69, "iC": "STGAVLFY", "jC": "VILM", "matrix": [[0.16, 0.10, -0.23, -0.09],[0.17, 0.07, -0.22, -0.02],[0.29, -0.07, -0.20, -0.02],[0.10, 0.12, -0.18, -0.14],[-0.01, 0.16, -0.06, -0.04],[-0.05, -0.19, 0.16, 0.08],[-0.58, -0.30, 0.57, 0.28],[-0.12, -0.11, 0.26, -0.03]]},
+ {"i": 103,"j": 78, "score": 1.44, "iC": "STGALMCFY", "jC": "KPAVILMFW", "matrix": [[-0.03, -0.04, -0.05, -0.15, -0.05, 0.35, -0.05, -0.01, 0.05],[-0.09, -0.13, -0.03, 0.47, 0.21, -0.03, -0.13, -0.13, -0.03],[-0.02, -0.06, 0.02, -0.26, -0.17, 0.25, 0.17, 0.11, -0.02],[-0.09, -0.49, -0.19, -0.50, -0.35, 0.87, 0.11, 0.65, 0.23],[-0.06, 0.18, 0.08, -0.01, 0.16, -0.23, 0.03, -0.09, -0.06],[0.01, 0.05, 0.12, 0.07, 0.24, -0.39, -0.05, -0.16, -0.04],[-0.02, -0.12, -0.03, 0.21, 0.10, 0.06, -0.02, -0.09, -0.02],[0.31, 0.57, 0.16, 0.26, -0.09, -0.76, -0.14, -0.30, -0.17],[0.01, 0.16, -0.03, -0.10, -0.18, -0.12, 0.14, -0.03, -0.01]]},
+ {"i": 103,"j": 81, "score": 0.61, "iC": "STGALF", "jC": "GAVL", "matrix": [[0.01, 0.18, -0.02, -0.08],[0.03, -0.16, -0.03, -0.07],[0.05, 0.18, -0.06, -0.06],[0.34, 0.39, -0.18, -0.29],[-0.14, -0.43, 0.04, 0.53],[-0.20, -0.12, 0.39, -0.16]]},
+ {"i": 103,"j": 93, "score": 0.96, "iC": "STGAILMF", "jC": "GVILF", "matrix": [[-0.02, -0.08, 0.28, -0.06, -0.05],[-0.04, 0.06, 0.27, -0.21, -0.02],[-0.02, -0.75, 0.10, 0.55, -0.01],[-0.16, 0.21, 0.14, -0.21, 0.22],[-0.01, 0.07, -0.21, -0.02, -0.01],[0.20, 0.27, -0.65, 0.11, -0.07],[0.13, 0.10, -0.23, 0.01, -0.05],[-0.06, 0.16, 0.18, -0.08, -0.09]]},
+ {"i": 103,"j": 102, "score": 0.43, "iC": "STGAVLMFW", "jC": "EKQSAILY", "matrix": [[0.09, -0.00, 0.09, 0.06, -0.18, -0.03, -0.08, -0.01],[0.10, -0.05, 0.18, -0.02, 0.10, -0.04, -0.17, -0.04],[0.07, 0.03, -0.28, -0.07, -0.10, 0.06, 0.24, 0.00],[0.10, 0.02, -0.17, -0.12, 0.06, -0.07, 0.11, -0.00],[0.15, -0.02, 0.09, 0.15, 0.01, -0.04, -0.16, -0.02],[-0.31, 0.07, 0.04, 0.05, 0.20, -0.08, 0.07, -0.07],[0.07, 0.03, 0.04, 0.06, 0.02, -0.05, -0.20, -0.04],[-0.30, -0.16, -0.26, -0.11, 0.08, 0.29, 0.31, 0.18],[-0.00, 0.03, 0.16, -0.02, -0.06, -0.01, -0.09, 0.00]]},
+ {"i": 103,"j": 106, "score": 0.40, "iC": "STGAVLMCF", "jC": "KRHQILMFY", "matrix": [[-0.13, -0.08, -0.05, -0.16, 0.24, 0.14, -0.02, 0.07, -0.03],[-0.15, -0.11, -0.15, -0.13, 0.20, 0.27, 0.18, -0.00, -0.18],[-0.06, -0.05, 0.03, 0.01, 0.00, -0.01, -0.04, 0.19, 0.19],[-0.04, -0.01, -0.07, -0.12, 0.05, 0.01, -0.09, 0.17, -0.06],[0.08, 0.01, -0.06, 0.08, -0.00, -0.02, -0.06, 0.01, -0.16],[0.03, 0.27, 0.09, 0.21, -0.19, -0.43, -0.05, -0.02, 0.08],[0.09, -0.06, 0.07, -0.08, -0.10, -0.05, -0.02, -0.10, 0.31],[0.00, -0.06, -0.11, -0.07, -0.01, 0.18, 0.16, -0.06, -0.06],[0.11, 0.02, 0.22, -0.01, -0.14, 0.06, 0.07, -0.19, 0.01]]},
+ {"i": 104,"j": 3, "score": 0.42, "iC": "VILMFW", "jC": "SAVILMFY", "matrix": [[0.01, -0.02, 0.19, -0.02, -0.07, -0.04, 0.01, -0.03],[-0.02, -0.12, 0.09, 0.20, 0.32, -0.18, -0.05, -0.10],[-0.29, -0.05, -0.04, 0.28, 0.33, -0.00, -0.22, -0.18],[0.24, 0.02, -0.13, -0.18, -0.03, 0.06, -0.10, 0.13],[-0.05, 0.03, -0.01, -0.02, -0.06, 0.10, 0.17, -0.01],[-0.02, 0.20, -0.03, -0.10, -0.12, -0.00, 0.03, 0.01]]},
+ {"i": 104,"j": 105, "score": 0.82, "iC": "EKVILMFW", "jC": "DEKHSPG", "matrix": [[-0.26, -0.10, 0.12, -0.02, 0.01, 0.14, -0.05],[0.14, 0.02, 0.01, 0.01, -0.01, -0.20, -0.03],[0.03, -0.02, 0.02, 0.02, -0.08, -0.17, 0.16],[0.26, 0.03, 0.13, 0.02, 0.02, -0.61, 0.27],[-0.40, -0.18, 0.01, -0.16, 0.15, 0.74, -0.17],[-0.02, 0.05, -0.17, 0.13, -0.08, 0.28, -0.21],[0.07, 0.04, -0.05, -0.02, -0.01, 0.17, 0.01],[0.20, -0.04, 0.03, -0.03, 0.01, -0.10, -0.06]]},
+ {"i": 104,"j": 128, "score": 0.43, "iC": "KLMFW", "jC": "VILFY", "matrix": [[-0.05, -0.15, 0.18, 0.07, -0.03],[0.08, -0.16, 0.15, 0.08, -0.02],[0.22, 0.47, -0.36, -0.28, 0.21],[-0.13, -0.08, -0.08, 0.24, -0.06],[0.05, 0.10, -0.03, -0.16, -0.09]]},
+ {"i": 105,"j": 104, "score": 0.82, "iC": "DEKHSPG", "jC": "EKVILMFW", "matrix": [[-0.26, 0.14, 0.03, 0.26, -0.40, -0.02, 0.07, 0.20],[-0.10, 0.02, -0.02, 0.03, -0.18, 0.05, 0.04, -0.04],[0.12, 0.01, 0.02, 0.13, 0.01, -0.17, -0.05, 0.03],[-0.02, 0.01, 0.02, 0.02, -0.16, 0.13, -0.02, -0.03],[0.01, -0.01, -0.08, 0.02, 0.15, -0.08, -0.01, 0.01],[0.14, -0.20, -0.17, -0.61, 0.74, 0.28, 0.17, -0.10],[-0.05, -0.03, 0.16, 0.27, -0.17, -0.21, 0.01, -0.06]]},
+ {"i": 105,"j": 106, "score": 0.91, "iC": "DEKRHNPGA", "jC": "DEKRHSLMFY", "matrix": [[0.07, 0.08, 0.30, 0.41, -0.17, 0.07, -0.17, -0.18, -0.23, -0.42],[0.07, 0.00, 0.25, 0.09, 0.08, -0.09, -0.20, -0.04, 0.03, -0.09],[0.06, 0.11, 0.04, -0.05, -0.08, -0.08, -0.21, 0.01, 0.06, 0.27],[-0.01, 0.02, -0.05, -0.09, 0.05, -0.07, -0.05, 0.06, 0.08, 0.16],[-0.00, -0.03, -0.01, -0.01, -0.01, -0.00, 0.27, -0.01, 0.01, -0.13],[0.10, 0.08, -0.05, 0.07, -0.05, -0.05, 0.16, 0.01, -0.14, -0.23],[-0.38, -0.24, -0.25, -0.35, 0.18, -0.22, 0.44, 0.19, 0.43, 0.58],[-0.05, -0.03, -0.08, 0.05, -0.13, 0.03, 0.18, 0.13, -0.14, -0.22],[0.09, -0.03, -0.10, -0.05, 0.05, 0.09, -0.18, -0.06, -0.03, 0.01]]},
+ {"i": 105,"j": 107, "score": 0.36, "iC": "DKHNPGA", "jC": "STAVI", "matrix": [[-0.06, -0.16, -0.21, 0.31, 0.16],[-0.06, -0.03, 0.17, -0.16, -0.02],[-0.03, -0.03, -0.09, 0.21, 0.01],[-0.02, -0.12, -0.12, 0.16, 0.10],[0.15, 0.23, 0.01, -0.18, -0.05],[-0.08, -0.16, -0.12, 0.30, 0.09],[0.02, 0.06, 0.15, -0.12, -0.03]]},
+ {"i": 106,"j": 78, "score": 0.47, "iC": "DEHQAILMFY", "jC": "KRPVILMF", "matrix": [[0.28, 0.22, -0.10, -0.30, -0.12, -0.08, 0.01, -0.05],[0.34, 0.02, -0.10, -0.10, -0.13, -0.07, 0.03, -0.05],[-0.14, -0.06, -0.08, 0.24, 0.01, -0.20, -0.01, 0.07],[0.04, -0.02, 0.18, -0.10, -0.14, -0.16, -0.01, 0.13],[0.02, 0.01, -0.05, 0.25, -0.04, -0.12, -0.03, 0.01],[-0.06, 0.07, -0.09, -0.17, -0.07, 0.25, -0.04, 0.09],[-0.11, 0.00, 0.10, 0.14, 0.08, 0.16, 0.02, -0.23],[-0.01, -0.02, 0.02, -0.07, 0.08, 0.18, -0.05, -0.11],[-0.08, -0.04, -0.02, 0.07, -0.07, -0.16, 0.17, 0.05],[-0.16, -0.07, -0.03, 0.32, 0.16, -0.11, -0.00, 0.00]]},
+ {"i": 106,"j": 79, "score": 0.82, "iC": "DEKRHQSVILFY", "jC": "DEKQNPAL", "matrix": [[-0.07, -0.21, -0.00, 0.09, 0.03, 0.03, 0.06, -0.02],[-0.16, -0.08, -0.01, 0.11, -0.04, 0.08, 0.03, -0.02],[0.39, 0.09, -0.04, -0.23, 0.04, -0.03, -0.13, -0.02],[1.00, 0.11, -0.15, -0.22, 0.09, -0.28, -0.33, -0.04],[0.20, 0.08, -0.07, -0.18, -0.02, 0.04, -0.06, 0.02],[-0.20, -0.12, 0.13, 0.03, -0.06, 0.04, 0.11, 0.11],[-0.21, -0.01, -0.06, -0.04, 0.03, 0.06, 0.07, -0.01],[-0.01, -0.15, -0.01, 0.10, -0.01, 0.02, 0.05, -0.01],[-0.08, -0.08, -0.00, -0.11, 0.16, 0.04, -0.01, 0.04],[-0.25, 0.10, -0.07, 0.36, -0.14, -0.05, 0.04, -0.15],[-0.22, 0.05, 0.05, 0.09, 0.03, -0.03, 0.06, 0.01],[-0.20, 0.06, 0.26, 0.05, -0.03, 0.11, -0.05, 0.01]]},
+ {"i": 106,"j": 82, "score": 0.49, "iC": "DEKRHSAILMY", "jC": "ERILMFY", "matrix": [[-0.05, 0.22, -0.10, -0.19, -0.08, 0.01, 0.27],[-0.05, 0.15, -0.15, -0.06, -0.09, 0.04, 0.05],[0.16, -0.05, -0.15, 0.03, -0.05, -0.11, 0.10],[0.08, -0.17, 0.12, -0.02, 0.05, 0.12, -0.07],[-0.02, -0.02, 0.01, 0.32, 0.04, 0.01, -0.00],[0.03, 0.00, -0.08, -0.17, -0.03, 0.03, 0.08],[0.01, -0.03, -0.17, 0.16, -0.01, -0.02, -0.00],[0.02, 0.01, 0.18, -0.14, -0.05, -0.20, -0.06],[0.01, -0.07, 0.25, -0.01, 0.20, -0.10, -0.15],[-0.00, -0.06, 0.01, -0.21, 0.09, -0.04, -0.06],[-0.11, -0.06, 0.31, 0.27, -0.04, 0.25, -0.15]]},
+ {"i": 106,"j": 103, "score": 0.40, "iC": "KRHQILMFY", "jC": "STGAVLMCF", "matrix": [[-0.13, -0.15, -0.06, -0.04, 0.08, 0.03, 0.09, 0.00, 0.11],[-0.08, -0.11, -0.05, -0.01, 0.01, 0.27, -0.06, -0.06, 0.02],[-0.05, -0.15, 0.03, -0.07, -0.06, 0.09, 0.07, -0.11, 0.22],[-0.16, -0.13, 0.01, -0.12, 0.08, 0.21, -0.08, -0.07, -0.01],[0.24, 0.20, 0.00, 0.05, -0.00, -0.19, -0.10, -0.01, -0.14],[0.14, 0.27, -0.01, 0.01, -0.02, -0.43, -0.05, 0.18, 0.06],[-0.02, 0.18, -0.04, -0.09, -0.06, -0.05, -0.02, 0.16, 0.07],[0.07, -0.00, 0.19, 0.17, 0.01, -0.02, -0.10, -0.06, -0.19],[-0.03, -0.18, 0.19, -0.06, -0.16, 0.08, 0.31, -0.06, 0.01]]},
+ {"i": 106,"j": 105, "score": 0.91, "iC": "DEKRHSLMFY", "jC": "DEKRHNPGA", "matrix": [[0.07, 0.07, 0.06, -0.01, -0.00, 0.10, -0.38, -0.05, 0.09],[0.08, 0.00, 0.11, 0.02, -0.03, 0.08, -0.24, -0.03, -0.03],[0.30, 0.25, 0.04, -0.05, -0.01, -0.05, -0.25, -0.08, -0.10],[0.41, 0.09, -0.05, -0.09, -0.01, 0.07, -0.35, 0.05, -0.05],[-0.17, 0.08, -0.08, 0.05, -0.01, -0.05, 0.18, -0.13, 0.05],[0.07, -0.09, -0.08, -0.07, -0.00, -0.05, -0.22, 0.03, 0.09],[-0.17, -0.20, -0.21, -0.05, 0.27, 0.16, 0.44, 0.18, -0.18],[-0.18, -0.04, 0.01, 0.06, -0.01, 0.01, 0.19, 0.13, -0.06],[-0.23, 0.03, 0.06, 0.08, 0.01, -0.14, 0.43, -0.14, -0.03],[-0.42, -0.09, 0.27, 0.16, -0.13, -0.23, 0.58, -0.22, 0.01]]},
+ {"i": 107,"j": 1, "score": 0.44, "iC": "AVC", "jC": "ILF", "matrix": [[0.51, -0.13, -0.22],[-0.19, 0.15, 0.00],[-0.27, -0.18, 0.33]]},
+ {"i": 107,"j": 3, "score": 1.48, "iC": "STAVILC", "jC": "SGAILMFY", "matrix": [[0.02, -0.02, -0.16, 0.11, -0.15, 0.13, -0.05, -0.02],[-0.01, -0.01, 0.20, 0.19, -0.32, 0.12, -0.20, -0.02],[-0.28, -0.24, -1.18, 0.23, 0.92, 0.41, 0.29, -0.11],[0.16, -0.13, -0.26, 0.09, -0.02, -0.23, 0.25, 0.30],[0.15, 0.15, 0.37, -0.30, -0.12, 0.00, -0.13, -0.04],[-0.01, 0.37, 0.43, -0.10, -0.30, -0.22, -0.08, -0.02],[-0.02, -0.10, 0.37, 0.04, -0.08, -0.07, -0.11, -0.07]]},
+ {"i": 107,"j": 105, "score": 0.36, "iC": "STAVI", "jC": "DKHNPGA", "matrix": [[-0.06, -0.06, -0.03, -0.02, 0.15, -0.08, 0.02],[-0.16, -0.03, -0.03, -0.12, 0.23, -0.16, 0.06],[-0.21, 0.17, -0.09, -0.12, 0.01, -0.12, 0.15],[0.31, -0.16, 0.21, 0.16, -0.18, 0.30, -0.12],[0.16, -0.02, 0.01, 0.10, -0.05, 0.09, -0.03]]},
+ {"i": 108,"j": 109, "score": 0.56, "iC": "DESTGA", "jC": "DKRHGV", "matrix": [[-0.40, 0.02, 0.03, -0.41, -0.05, 0.28],[-0.06, 0.20, -0.04, -0.05, -0.07, 0.04],[0.19, -0.01, -0.04, 0.06, -0.04, -0.07],[0.49, -0.13, -0.24, 0.60, 0.07, -0.20],[0.01, 0.08, -0.17, 0.02, -0.02, 0.01],[-0.02, -0.07, -0.05, 0.02, 0.17, 0.04]]},
+ {"i": 109,"j": 2, "score": 0.82, "iC": "EKRQTAVILCY", "jC": "EKRHQNSTGAV", "matrix": [[-0.12, 0.61, 0.46, -0.12, 0.02, -0.34, 0.15, -0.25, -0.15, 0.02, 0.02],[-0.02, -0.28, -0.05, -0.00, -0.00, 0.14, 0.09, 0.15, -0.04, -0.21, 0.00],[-0.00, -0.40, -0.27, -0.28, -0.12, 0.32, 0.26, 0.26, -0.12, -0.01, 0.24],[-0.04, 0.18, -0.06, 0.05, -0.04, -0.03, -0.00, -0.02, -0.07, -0.02, -0.01],[0.08, 0.07, -0.09, 0.10, 0.05, -0.02, -0.15, -0.08, 0.06, 0.17, -0.13],[0.02, 0.07, -0.02, -0.03, 0.15, -0.03, -0.09, 0.18, -0.08, -0.18, 0.01],[0.16, -0.13, -0.05, 0.10, 0.05, 0.04, -0.18, -0.18, 0.30, 0.07, -0.02],[0.08, -0.08, -0.03, 0.05, -0.01, 0.01, 0.00, -0.17, 0.04, 0.09, -0.01],[-0.03, -0.02, 0.05, -0.03, -0.01, -0.04, -0.09, -0.06, 0.18, 0.09, -0.01],[-0.03, -0.04, -0.03, 0.01, -0.01, -0.02, 0.10, 0.23, -0.04, -0.08, -0.01],[0.00, -0.07, -0.01, -0.02, -0.02, 0.01, 0.00, -0.04, -0.03, 0.23, -0.00]]},
+ {"i": 109,"j": 90, "score": 0.75, "iC": "EKRVY", "jC": "DEKRN", "matrix": [[-0.11, -0.55, 0.45, -0.05, 0.08],[-0.01, 0.72, -0.34, -0.23, -0.03],[-0.07, 0.56, -0.48, 0.00, 0.06],[0.19, 0.02, -0.10, -0.02, 0.16],[-0.09, -0.19, 0.07, 0.06, 0.01]]},
+ {"i": 109,"j": 108, "score": 0.56, "iC": "DKRHGV", "jC": "DESTGA", "matrix": [[-0.40, -0.06, 0.19, 0.49, 0.01, -0.02],[0.02, 0.20, -0.01, -0.13, 0.08, -0.07],[0.03, -0.04, -0.04, -0.24, -0.17, -0.05],[-0.41, -0.05, 0.06, 0.60, 0.02, 0.02],[-0.05, -0.07, -0.04, 0.07, -0.02, 0.17],[0.28, 0.04, -0.07, -0.20, 0.01, 0.04]]},
+ {"i": 109,"j": 111, "score": 0.80, "iC": "EKRQTGVICY", "jC": "EHVILCFWY", "matrix": [[-0.43, 0.04, 0.16, 0.29, 0.17, 0.04, -0.05, 0.24, -0.49],[-0.10, -0.21, 0.01, 0.19, -0.13, 0.02, 0.20, -0.06, 0.22],[0.51, -0.42, -0.08, 0.06, 0.19, 0.15, -0.10, -0.14, 0.27],[-0.06, -0.09, 0.02, 0.06, 0.10, -0.01, 0.05, 0.03, -0.19],[-0.17, 0.08, -0.04, -0.09, -0.02, -0.05, 0.04, -0.01, 0.23],[-0.03, -0.06, 0.17, 0.01, -0.09, -0.01, 0.03, 0.02, -0.10],[0.15, 0.47, -0.07, -0.15, -0.21, -0.02, -0.14, 0.04, -0.10],[-0.03, 0.18, 0.01, -0.09, -0.13, -0.02, -0.03, 0.01, 0.02],[0.17, 0.11, -0.06, -0.03, -0.01, -0.02, -0.04, -0.01, -0.10],[-0.03, -0.04, -0.05, -0.04, 0.04, -0.01, -0.02, -0.01, 0.21]]},
+ {"i": 109,"j": 154, "score": 1.21, "iC": "DEKRHNTAVICY", "jC": "DEKRHSTVILM", "matrix": [[-0.01, -0.10, -0.05, 0.06, 0.55, -0.02, -0.27, -0.10, -0.07, -0.03, -0.02],[-0.10, -0.39, 0.23, 0.27, 0.30, -0.07, -0.21, -0.05, -0.20, -0.09, -0.07],[0.07, 0.67, -0.44, -0.32, -0.18, -0.02, 0.20, 0.21, 0.23, -0.16, -0.15],[-0.01, 0.09, -0.48, -0.54, -0.36, 0.23, 0.10, 0.46, 0.28, -0.11, 0.31],[0.20, 0.08, -0.04, -0.14, -0.04, 0.02, -0.17, -0.02, -0.10, 0.19, -0.05],[-0.03, -0.04, -0.00, -0.04, 0.08, -0.02, -0.01, -0.07, -0.06, 0.21, 0.00],[-0.07, 0.01, 0.20, 0.22, -0.12, -0.03, 0.37, -0.09, -0.07, -0.20, -0.08],[0.05, -0.08, -0.00, 0.24, -0.05, -0.03, -0.10, -0.04, -0.05, 0.04, -0.03],[-0.10, -0.05, 0.28, 0.25, -0.09, -0.06, 0.12, -0.11, -0.05, -0.04, 0.08],[-0.04, -0.03, 0.23, -0.00, -0.03, -0.03, 0.12, -0.04, -0.12, 0.00, 0.05],[-0.02, -0.04, 0.05, -0.01, -0.03, -0.03, 0.16, 0.03, -0.01, -0.03, 0.00],[-0.00, 0.02, 0.08, -0.01, -0.04, -0.02, -0.16, 0.00, 0.09, 0.09, -0.04]]},
+ {"i": 109,"j": 156, "score": 1.22, "iC": "DEKRQTVIY", "jC": "DEKRQVIL", "matrix": [[-0.04, -0.19, 0.01, 0.05, -0.04, 0.05, -0.01, 0.01],[-0.15, -0.51, 0.22, 0.42, 0.03, 0.02, 0.04, -0.06],[-0.31, 0.29, -0.29, -0.34, -0.11, 0.22, 0.23, 0.27],[0.93, 0.70, -0.63, -0.44, -0.09, 0.03, -0.11, -0.04],[-0.01, -0.16, -0.08, 0.05, 0.13, -0.04, -0.04, 0.04],[-0.05, -0.08, 0.30, 0.11, 0.08, -0.13, -0.07, -0.09],[-0.08, 0.10, -0.04, 0.10, -0.21, 0.08, -0.04, -0.04],[-0.08, -0.14, 0.27, 0.01, 0.10, -0.02, 0.08, -0.05],[-0.04, 0.01, 0.18, 0.07, 0.03, -0.09, -0.01, -0.02]]},
+ {"i": 110,"j": 5, "score": 0.56, "iC": "VILM", "jC": "AVLFWY", "matrix": [[-0.26, 0.02, 0.13, 0.06, -0.07, 0.23],[-0.28, 0.18, 0.20, 0.00, -0.11, 0.06],[0.25, -0.13, -0.31, -0.26, 0.50, -0.23],[0.20, 0.02, -0.07, 0.16, -0.28, -0.05]]},
+ {"i": 110,"j": 7, "score": 0.60, "iC": "AVILM", "jC": "ERQTAVILM", "matrix": [[-0.05, 0.05, 0.05, -0.01, 0.01, 0.19, -0.10, -0.07, -0.11],[0.01, 0.14, -0.10, 0.11, 0.33, -0.21, -0.13, -0.09, -0.19],[-0.01, -0.05, 0.06, 0.19, 0.30, -0.06, -0.16, -0.41, 0.14],[0.26, -0.25, 0.17, -0.04, -0.41, 0.07, 0.17, 0.28, 0.09],[-0.10, -0.00, -0.18, -0.16, -0.18, -0.16, 0.26, 0.27, 0.16]]},
+ {"i": 110,"j": 112, "score": 1.32, "iC": "AVILMC", "jC": "ERAVILM", "matrix": [[-0.02, -0.07, -0.08, 0.17, 0.46, -0.32, -0.04],[0.17, -0.01, 0.21, -0.27, -0.48, 0.30, 0.05],[-0.04, 0.27, 0.28, -0.76, -0.92, 0.38, 0.36],[-0.10, -0.03, -0.27, 0.30, 0.42, -0.07, -0.22],[-0.02, -0.07, -0.09, 0.13, 0.40, -0.12, -0.08],[-0.01, -0.03, -0.02, 0.27, -0.03, -0.13, -0.02]]},
+ {"i": 110,"j": 125, "score": 0.44, "iC": "QAVILM", "jC": "VLFY", "matrix": [[0.00, -0.03, -0.22, 0.24],[-0.01, 0.19, -0.30, -0.05],[0.15, -0.06, -0.08, 0.01],[0.02, -0.26, 0.07, -0.08],[-0.13, 0.09, 0.30, -0.18],[-0.06, -0.04, 0.40, 0.01]]},
+ {"i": 110,"j": 128, "score": 1.26, "iC": "AVILMC", "jC": "PVILMFWY", "matrix": [[-0.07, -0.17, -0.21, 0.39, 0.15, 0.01, -0.08, -0.09],[-0.12, -0.12, -0.20, 0.70, 0.23, -0.22, -0.16, -0.15],[0.15, 0.04, 0.46, 0.08, -0.03, -0.02, -0.36, -0.40],[0.02, 0.24, 0.54, -0.74, -0.21, 0.06, 0.09, 0.33],[-0.04, 0.19, -0.24, -0.61, -0.08, 0.31, 0.40, 0.25],[0.04, -0.07, -0.15, 0.21, 0.01, -0.10, 0.03, -0.02]]},
+ {"i": 111,"j": 2, "score": 1.37, "iC": "DERHVILFY", "jC": "EKHQNSTAVIC", "matrix": [[-0.01, -0.03, 0.05, -0.01, -0.03, -0.14, 0.15, -0.05, 0.01, 0.05, 0.02],[-0.07, 0.01, -0.07, -0.05, -0.22, -0.40, 0.17, -0.14, 0.38, 0.30, -0.04],[0.06, -0.05, 0.01, 0.03, -0.05, -0.14, 0.24, -0.08, 0.04, 0.07, -0.01],[0.32, -0.07, 0.16, 0.24, 0.08, 0.16, -0.29, 0.03, -0.10, -0.18, -0.01],[0.00, 0.02, 0.08, -0.06, -0.05, 0.04, 0.15, -0.08, 0.04, -0.06, -0.06],[-0.07, 0.29, -0.08, 0.02, -0.19, -0.10, 0.18, -0.15, 0.08, 0.13, -0.03],[-0.11, -0.08, -0.08, -0.04, 0.01, -0.12, 0.45, -0.13, -0.03, 0.07, -0.05],[-0.06, -0.06, -0.03, -0.04, 0.13, 0.07, -0.28, 0.21, -0.09, -0.08, 0.05],[-0.07, 0.04, -0.00, -0.09, 0.41, 0.74, -1.07, 0.64, -0.42, -0.26, 0.20]]},
+ {"i": 111,"j": 29, "score": 0.98, "iC": "DERHVILY", "jC": "RHLFWY", "matrix": [[0.36, -0.13, -0.02, -0.09, -0.01, -0.06],[0.43, 0.47, -0.07, -0.36, -0.05, -0.23],[0.09, -0.28, 0.00, 0.13, -0.03, 0.08],[0.06, -0.11, 0.17, -0.22, -0.02, 0.13],[-0.45, 0.38, 0.10, 0.04, -0.06, -0.26],[-0.28, 0.44, 0.04, 0.08, -0.07, -0.37],[-0.15, -0.38, -0.03, 0.30, -0.04, 0.38],[-0.22, -0.37, -0.21, 0.28, 0.21, 0.33]]},
+ {"i": 111,"j": 33, "score": 0.86, "iC": "DERHVILFY", "jC": "EKQTAVILMY", "matrix": [[-0.02, -0.02, 0.01, -0.03, 0.02, 0.27, -0.04, -0.13, -0.03, -0.01],[-0.09, 0.09, -0.14, -0.42, -0.11, -0.09, 0.16, 0.54, 0.16, -0.02],[0.05, -0.05, 0.01, -0.11, 0.03, 0.03, 0.04, -0.12, -0.06, 0.17],[0.12, -0.06, -0.01, -0.01, -0.06, -0.09, 0.08, 0.16, 0.05, -0.02],[0.02, -0.12, 0.04, 0.21, 0.01, -0.21, -0.22, -0.11, 0.03, 0.24],[0.12, -0.18, 0.13, 0.35, 0.01, -0.02, -0.08, -0.38, -0.13, 0.07],[0.03, -0.08, 0.24, 0.08, 0.20, 0.04, -0.09, -0.58, -0.11, -0.05],[-0.05, 0.13, -0.06, 0.03, -0.05, -0.03, -0.06, 0.23, -0.02, -0.03],[-0.41, 0.20, -0.21, 0.03, -0.03, 0.13, 0.27, 0.29, 0.13, -0.28]]},
+ {"i": 111,"j": 90, "score": 0.39, "iC": "ELFY", "jC": "EKRST", "matrix": [[-0.37, 0.07, 0.02, 0.03, 0.15],[-0.09, 0.22, 0.39, -0.06, -0.21],[-0.19, -0.09, -0.14, 0.15, 0.00],[0.57, -0.19, -0.23, -0.01, -0.06]]},
+ {"i": 111,"j": 109, "score": 0.80, "iC": "EHVILCFWY", "jC": "EKRQTGVICY", "matrix": [[-0.43, -0.10, 0.51, -0.06, -0.17, -0.03, 0.15, -0.03, 0.17, -0.03],[0.04, -0.21, -0.42, -0.09, 0.08, -0.06, 0.47, 0.18, 0.11, -0.04],[0.16, 0.01, -0.08, 0.02, -0.04, 0.17, -0.07, 0.01, -0.06, -0.05],[0.29, 0.19, 0.06, 0.06, -0.09, 0.01, -0.15, -0.09, -0.03, -0.04],[0.17, -0.13, 0.19, 0.10, -0.02, -0.09, -0.21, -0.13, -0.01, 0.04],[0.04, 0.02, 0.15, -0.01, -0.05, -0.01, -0.02, -0.02, -0.02, -0.01],[-0.05, 0.20, -0.10, 0.05, 0.04, 0.03, -0.14, -0.03, -0.04, -0.02],[0.24, -0.06, -0.14, 0.03, -0.01, 0.02, 0.04, 0.01, -0.01, -0.01],[-0.49, 0.22, 0.27, -0.19, 0.23, -0.10, -0.10, 0.02, -0.10, 0.21]]},
+ {"i": 111,"j": 152, "score": 0.38, "iC": "EHVIF", "jC": "VIFY", "matrix": [[-0.18, -0.30, 0.29, 0.21],[-0.05, -0.06, -0.04, 0.23],[0.27, 0.18, -0.37, -0.09],[0.15, 0.16, -0.29, 0.01],[0.04, 0.04, 0.13, -0.19]]},
+ {"i": 111,"j": 154, "score": 0.88, "iC": "ERHQILCFY", "jC": "DEKRQSTVIL", "matrix": [[-0.34, -0.32, -0.03, 0.55, -0.02, 0.53, 0.54, -0.32, -0.19, -0.13],[0.23, -0.08, -0.03, -0.05, -0.02, -0.04, -0.10, 0.01, -0.07, -0.04],[0.13, -0.10, 0.18, -0.03, -0.04, -0.03, 0.01, 0.02, -0.01, 0.08],[-0.06, 0.19, -0.02, -0.05, 0.05, -0.02, -0.03, -0.05, 0.00, -0.01],[-0.09, 0.06, -0.10, -0.03, 0.00, -0.07, 0.09, 0.12, -0.07, -0.15],[-0.04, 0.19, -0.06, 0.03, -0.10, 0.01, 0.04, -0.19, -0.14, 0.14],[0.17, 0.00, -0.01, -0.05, -0.01, -0.02, -0.13, 0.04, -0.00, -0.01],[0.05, 0.06, -0.02, -0.06, 0.01, -0.03, -0.22, 0.06, 0.00, 0.08],[-0.08, -0.05, 0.17, -0.23, 0.17, -0.29, -0.15, 0.39, 0.49, -0.01]]},
+ {"i": 112,"j": 5, "score": 1.06, "iC": "RAVIL", "jC": "SAVFWY", "matrix": [[-0.01, -0.11, -0.12, 0.03, 0.18, 0.13],[-0.01, -0.18, 0.28, -0.00, -0.05, 0.01],[-0.11, -0.70, 0.37, 0.16, 0.27, 0.16],[0.02, 0.33, 0.08, 0.00, -0.23, -0.19],[0.19, 0.80, -0.37, -0.32, -0.44, -0.25]]},
+ {"i": 112,"j": 7, "score": 0.83, "iC": "EKRAVILMF", "jC": "ERHQTAVILMY", "matrix": [[-0.02, 0.17, -0.01, -0.08, 0.02, -0.03, -0.01, -0.02, 0.02, -0.01, -0.01],[0.19, -0.03, -0.01, -0.03, 0.02, -0.00, -0.01, -0.03, -0.02, -0.10, -0.02],[0.32, -0.05, -0.03, 0.12, 0.06, -0.08, -0.05, -0.07, -0.03, -0.18, -0.03],[-0.03, -0.04, -0.01, -0.07, -0.02, -0.14, -0.17, -0.04, 0.05, -0.07, 0.49],[-0.01, 0.05, 0.13, 0.25, -0.24, -0.38, -0.13, 0.11, -0.06, 0.30, -0.03],[-0.17, 0.07, 0.30, -0.06, -0.06, -0.21, 0.11, 0.15, -0.24, 0.14, -0.03],[-0.24, -0.10, -0.35, -0.23, -0.06, 0.53, 0.11, 0.11, 0.37, 0.13, -0.29],[-0.03, 0.01, -0.04, 0.04, -0.04, 0.10, 0.16, -0.06, -0.02, 0.00, -0.05],[-0.03, -0.03, -0.02, -0.03, 0.02, 0.17, 0.09, -0.08, 0.00, -0.08, -0.02]]},
+ {"i": 112,"j": 110, "score": 1.32, "iC": "ERAVILM", "jC": "AVILMC", "matrix": [[-0.02, 0.17, -0.04, -0.10, -0.02, -0.01],[-0.07, -0.01, 0.27, -0.03, -0.07, -0.03],[-0.08, 0.21, 0.28, -0.27, -0.09, -0.02],[0.17, -0.27, -0.76, 0.30, 0.13, 0.27],[0.46, -0.48, -0.92, 0.42, 0.40, -0.03],[-0.32, 0.30, 0.38, -0.07, -0.12, -0.13],[-0.04, 0.05, 0.36, -0.22, -0.08, -0.02]]},
+ {"i": 112,"j": 114, "score": 0.58, "iC": "KRQAVILMF", "jC": "EKRHQVILWY", "matrix": [[0.20, -0.12, -0.11, -0.04, -0.03, 0.08, -0.05, -0.03, -0.01, -0.02],[-0.26, -0.10, -0.24, -0.10, -0.07, 0.24, 0.14, 0.26, -0.01, -0.04],[-0.09, -0.04, -0.10, -0.04, 0.15, 0.06, 0.14, -0.01, -0.01, -0.02],[0.23, -0.08, -0.06, -0.04, -0.02, 0.05, 0.03, -0.04, -0.01, 0.00],[-0.05, 0.17, 0.08, 0.18, -0.04, -0.15, -0.14, -0.20, 0.06, 0.12],[0.26, 0.19, 0.10, 0.28, 0.06, -0.28, -0.43, -0.07, 0.21, 0.07],[0.03, -0.04, 0.25, -0.17, -0.03, 0.00, 0.10, 0.10, -0.22, -0.20],[-0.17, 0.08, 0.12, -0.06, -0.06, -0.01, 0.03, -0.01, -0.01, 0.12],[-0.12, -0.04, 0.16, -0.00, 0.01, -0.03, -0.04, -0.02, 0.01, 0.04]]},
+ {"i": 112,"j": 155, "score": 0.55, "iC": "RAVIL", "jC": "LFWY", "matrix": [[0.02, 0.19, 0.17, -0.36],[-0.15, 0.02, -0.07, 0.15],[-0.32, -0.08, 0.00, 0.45],[-0.20, -0.02, 0.01, 0.17],[0.49, -0.04, -0.11, -0.19]]},
+ {"i": 114,"j": 7, "score": 0.86, "iC": "DEKRHQVILFW", "jC": "EKRHQAVILMY", "matrix": [[-0.10, 0.02, 0.17, -0.02, 0.21, 0.05, -0.08, -0.07, -0.06, -0.12, -0.02],[-0.10, 0.30, 0.51, 0.03, -0.12, -0.07, 0.07, -0.25, -0.31, -0.42, 0.50],[0.29, -0.12, -0.05, -0.00, -0.06, 0.04, 0.21, -0.11, -0.01, -0.12, -0.03],[0.10, -0.17, -0.30, -0.09, -0.31, 0.70, 0.10, -0.08, 0.07, -0.10, -0.13],[-0.12, -0.09, -0.15, -0.11, -0.07, -0.14, 0.18, 0.36, 0.22, 0.04, -0.07],[-0.05, 0.04, 0.01, -0.03, 0.29, -0.08, 0.02, -0.00, -0.06, -0.07, -0.05],[0.15, 0.03, 0.04, 0.07, 0.02, -0.01, -0.17, -0.04, -0.05, 0.01, -0.06],[0.04, 0.00, 0.04, -0.05, 0.04, -0.15, -0.26, 0.13, -0.03, 0.21, -0.00],[-0.07, -0.04, -0.09, 0.17, -0.00, -0.24, -0.13, 0.09, 0.03, 0.14, -0.02],[-0.08, 0.01, -0.05, -0.02, -0.01, -0.05, -0.09, 0.09, -0.01, 0.26, -0.00],[-0.04, -0.01, -0.03, -0.04, -0.02, -0.04, -0.01, -0.00, 0.18, 0.09, -0.02]]},
+ {"i": 114,"j": 9, "score": 0.41, "iC": "DEKRHQVILWY", "jC": "DEKRQAL", "matrix": [[-0.07, -0.17, 0.01, 0.17, -0.01, 0.02, -0.05],[-0.21, -0.39, 0.22, 0.25, 0.17, -0.04, -0.21],[0.14, 0.20, -0.22, -0.10, 0.02, 0.03, -0.08],[0.30, 0.22, -0.15, -0.11, -0.09, 0.03, 0.00],[0.27, -0.17, -0.12, 0.01, 0.05, 0.04, -0.15],[0.06, -0.19, -0.05, -0.10, 0.04, 0.15, 0.14],[-0.13, 0.21, -0.07, -0.09, -0.02, -0.04, 0.12],[-0.13, 0.16, 0.15, -0.10, 0.00, 0.01, 0.06],[-0.07, 0.02, 0.03, 0.14, -0.03, -0.17, 0.24],[-0.01, -0.07, 0.00, 0.18, -0.04, -0.00, 0.02],[0.00, -0.01, 0.17, -0.10, -0.02, -0.08, -0.01]]},
+ {"i": 114,"j": 11, "score": 0.53, "iC": "EKRVIL", "jC": "DKRNGWY", "matrix": [[-0.15, 0.18, 0.22, -0.15, 0.15, -0.27, -0.07],[-0.06, -0.00, -0.30, 0.04, 0.09, 0.18, 0.04],[0.42, -0.12, -0.36, 0.58, -0.16, 0.07, -0.21],[-0.05, 0.11, 0.30, -0.10, 0.08, -0.09, 0.07],[-0.03, -0.06, 0.07, -0.11, 0.07, -0.03, 0.15],[-0.02, -0.03, 0.18, -0.02, -0.08, -0.01, -0.03]]},
+ {"i": 114,"j": 112, "score": 0.58, "iC": "EKRHQVILWY", "jC": "KRQAVILMF", "matrix": [[0.20, -0.26, -0.09, 0.23, -0.05, 0.26, 0.03, -0.17, -0.12],[-0.12, -0.10, -0.04, -0.08, 0.17, 0.19, -0.04, 0.08, -0.04],[-0.11, -0.24, -0.10, -0.06, 0.08, 0.10, 0.25, 0.12, 0.16],[-0.04, -0.10, -0.04, -0.04, 0.18, 0.28, -0.17, -0.06, -0.00],[-0.03, -0.07, 0.15, -0.02, -0.04, 0.06, -0.03, -0.06, 0.01],[0.08, 0.24, 0.06, 0.05, -0.15, -0.28, 0.00, -0.01, -0.03],[-0.05, 0.14, 0.14, 0.03, -0.14, -0.43, 0.10, 0.03, -0.04],[-0.03, 0.26, -0.01, -0.04, -0.20, -0.07, 0.10, -0.01, -0.02],[-0.01, -0.01, -0.01, -0.01, 0.06, 0.21, -0.22, -0.01, 0.01],[-0.02, -0.04, -0.02, 0.00, 0.12, 0.07, -0.20, 0.12, 0.04]]},
+ {"i": 114,"j": 130, "score": 0.48, "iC": "EKRHLFY", "jC": "EKRPLFWY", "matrix": [[-0.22, 0.33, 0.63, 0.01, 0.01, -0.19, -0.27, -0.09],[0.26, -0.21, -0.05, -0.06, -0.05, -0.06, 0.21, 0.15],[0.26, -0.20, -0.23, -0.08, 0.03, -0.01, 0.17, -0.19],[-0.21, -0.10, -0.15, 0.32, -0.06, -0.06, 0.20, -0.06],[0.06, -0.03, -0.16, -0.07, -0.01, 0.03, -0.04, -0.02],[-0.04, 0.18, -0.01, -0.19, -0.09, 0.18, 0.12, -0.01],[0.04, 0.02, -0.03, 0.02, 0.19, -0.06, -0.13, -0.01]]},
+ {"i": 114,"j": 151, "score": 0.40, "iC": "EKRHVILY", "jC": "DERQSTAVY", "matrix": [[0.33, -0.41, 0.31, -0.20, 0.00, -0.17, 0.11, 0.05, -0.12],[-0.07, 0.24, -0.27, 0.08, 0.03, -0.00, 0.04, 0.00, -0.05],[0.15, -0.05, -0.13, -0.10, -0.08, 0.06, 0.05, 0.29, -0.05],[-0.00, 0.13, 0.20, -0.10, -0.18, -0.11, -0.16, -0.09, -0.04],[-0.04, -0.06, 0.08, -0.00, -0.01, 0.27, -0.12, -0.03, -0.06],[-0.15, -0.18, 0.05, 0.02, 0.13, 0.05, 0.14, -0.06, -0.01],[0.00, -0.05, -0.12, 0.03, 0.21, -0.03, -0.07, -0.00, -0.01],[-0.05, 0.05, -0.05, -0.00, -0.02, -0.18, -0.03, -0.05, 0.25]]},
+ {"i": 114,"j": 153, "score": 1.49, "iC": "DEKRHTVILFY", "jC": "DEKRHQNSAVILMCY", "matrix": [[-0.03, -0.16, 0.13, 0.26, -0.03, -0.02, -0.02, 0.19, -0.06, -0.15, -0.06, -0.12, -0.03, -0.02, -0.03],[-0.07, -0.79, 0.49, 0.20, 0.01, -0.37, 0.21, -0.13, -0.09, 0.64, -0.10, 0.04, -0.03, -0.02, -0.06],[-0.04, 0.05, -0.15, -0.40, 0.20, 0.03, 0.01, 0.03, -0.09, -0.12, 0.17, 0.15, -0.07, 0.15, 0.18],[0.04, 1.07, -0.46, -0.41, 0.01, 0.22, -0.14, -0.12, -0.24, -0.45, 0.16, 0.16, 0.19, -0.02, -0.01],[-0.04, 0.08, 0.02, -0.08, -0.04, -0.10, -0.03, 0.16, 0.39, 0.15, -0.20, -0.39, -0.09, 0.25, -0.08],[0.19, 0.04, -0.02, -0.01, -0.03, 0.04, 0.03, 0.13, 0.06, -0.13, -0.06, -0.17, -0.03, -0.04, -0.04],[-0.05, 0.19, -0.07, 0.05, -0.01, -0.05, -0.02, 0.03, -0.02, -0.24, 0.01, -0.02, 0.03, -0.07, 0.22],[-0.03, -0.02, -0.05, -0.09, 0.03, -0.09, 0.04, -0.03, -0.05, 0.09, -0.02, 0.20, -0.01, 0.06, 0.02],[-0.05, -0.14, -0.06, 0.00, -0.03, 0.16, -0.00, -0.06, -0.09, -0.05, 0.17, 0.26, 0.12, -0.10, -0.05],[-0.02, -0.02, -0.02, 0.12, -0.02, -0.08, -0.01, -0.04, 0.14, 0.29, -0.10, -0.21, -0.05, -0.05, -0.04],[-0.02, -0.14, 0.02, 0.45, -0.04, -0.12, -0.03, -0.04, 0.01, 0.17, -0.01, -0.17, 0.04, -0.02, -0.08]]},
+ {"i": 114,"j": 155, "score": 0.58, "iC": "DEKRHTVIFW", "jC": "LFWY", "matrix": [[0.06, 0.19, -0.05, -0.18],[0.02, -0.08, -0.19, 0.23],[0.20, -0.04, -0.09, 0.06],[-0.15, -0.20, 0.22, 0.06],[-0.15, -0.29, -0.19, 0.57],[0.09, 0.07, 0.05, -0.17],[0.06, -0.11, 0.24, -0.22],[0.09, 0.01, 0.05, -0.21],[-0.14, 0.33, -0.05, -0.18],[-0.07, -0.03, -0.07, 0.19]]},
+ {"i": 115,"j": 21, "score": 0.50, "iC": "VIL", "jC": "CFW", "matrix": [[-0.32, 0.30, 0.31],[0.27, -0.24, -0.08],[0.02, -0.07, 0.15]]},
+ {"i": 115,"j": 23, "score": 0.63, "iC": "VIL", "jC": "VILMC", "matrix": [[-0.39, 0.44, 0.39, -0.24, -0.21],[-0.07, -0.07, -0.02, 0.20, 0.05],[0.31, -0.08, -0.24, -0.02, 0.15]]},
+ {"i": 115,"j": 117, "score": 0.48, "iC": "VI", "jC": "RHQTGL", "matrix": [[-0.15, -0.22, -0.08, 0.17, 0.55, 0.02],[0.11, 0.26, 0.18, -0.21, -0.41, -0.17]]},
+ {"i": 115,"j": 119, "score": 0.41, "iC": "VI", "jC": "KTPGVFY", "matrix": [[-0.19, -0.14, 0.38, 0.18, 0.10, -0.25, -0.31],[0.20, 0.19, -0.17, -0.10, -0.22, 0.23, 0.24]]},
+ {"i": 116,"j": 9, "score": 1.86, "iC": "DEKRHQNPALF", "jC": "DEKRHQNPAL", "matrix": [[-0.56, -1.16, 0.86, 0.93, 0.36, -0.29, 0.41, -0.22, 0.02, -0.31],[-0.13, -0.49, 0.18, 0.43, -0.01, 0.10, -0.17, 0.04, -0.11, 0.01],[0.09, 0.41, -0.21, -0.20, -0.02, 0.03, -0.12, 0.03, -0.02, 0.05],[0.20, 0.27, -0.13, -0.09, 0.01, -0.08, -0.08, 0.00, -0.04, 0.04],[0.82, 0.76, -0.39, -0.54, -0.16, -0.05, -0.23, 0.07, -0.05, -0.20],[-0.08, -0.10, 0.02, -0.12, 0.02, 0.09, -0.10, 0.09, 0.01, 0.30],[-0.10, -0.23, 0.11, 0.02, -0.08, -0.17, 0.27, -0.05, -0.07, 0.19],[0.03, 0.15, -0.05, 0.12, -0.02, 0.00, -0.01, 0.01, -0.01, -0.07],[-0.08, 0.15, -0.09, -0.17, -0.06, 0.05, -0.03, -0.03, 0.28, -0.03],[-0.11, -0.02, -0.08, -0.14, -0.02, 0.21, 0.04, -0.09, -0.07, 0.01],[-0.05, 0.15, -0.06, 0.02, -0.01, -0.01, -0.03, 0.09, -0.08, 0.01]]},
+ {"i": 116,"j": 117, "score": 0.49, "iC": "DEKHQNPGALY", "jC": "EKHQNSTGAVILFY", "matrix": [[-0.16, -0.14, -0.04, -0.21, -0.20, -0.15, 0.00, -0.21, 0.29, 0.16, 0.17, 0.23, 0.17, 0.19],[-0.06, 0.10, -0.10, -0.02, 0.04, -0.02, 0.04, 0.21, -0.08, -0.10, 0.05, 0.01, -0.00, -0.03],[0.05, 0.06, -0.18, 0.01, -0.06, -0.04, -0.06, 0.26, 0.01, -0.08, -0.07, 0.02, 0.01, -0.04],[0.17, -0.12, 0.39, 0.08, 0.11, -0.02, 0.08, -0.31, 0.07, -0.05, -0.10, -0.34, -0.05, 0.02],[0.03, 0.07, -0.11, 0.02, 0.06, 0.06, 0.17, 0.06, -0.07, 0.02, -0.05, -0.13, -0.03, -0.02],[-0.11, -0.02, 0.06, 0.09, -0.06, -0.01, 0.01, -0.12, -0.01, 0.05, 0.15, -0.01, -0.00, -0.01],[0.09, -0.06, -0.04, -0.03, -0.01, -0.04, -0.09, 0.29, -0.18, -0.02, -0.02, 0.12, 0.02, -0.02],[-0.09, -0.00, -0.11, 0.05, 0.01, -0.06, -0.04, -0.12, -0.03, 0.16, 0.05, 0.05, 0.02, -0.02],[-0.04, -0.13, 0.05, -0.01, -0.05, -0.03, -0.12, 0.06, -0.10, 0.04, 0.01, 0.26, -0.02, 0.01],[0.02, 0.06, 0.05, 0.10, 0.10, 0.19, -0.05, -0.09, -0.00, -0.03, -0.05, -0.10, -0.02, -0.02],[0.07, 0.21, 0.04, 0.02, -0.02, -0.09, -0.06, -0.08, -0.01, -0.02, -0.03, -0.03, -0.02, -0.03]]},
+ {"i": 116,"j": 149, "score": 0.83, "iC": "DEKRHNGA", "jC": "DEKRQNSTPGA", "matrix": [[-0.23, -0.61, 0.16, 0.47, -0.16, 0.23, 0.13, -0.01, -0.09, 0.32, -0.08],[-0.28, -0.32, 0.26, 0.21, -0.12, 0.05, -0.19, 0.01, 0.04, 0.06, 0.12],[0.05, 0.28, -0.17, -0.15, 0.32, -0.14, -0.15, -0.00, -0.12, -0.02, -0.02],[-0.11, 0.20, -0.05, -0.09, 0.04, -0.07, -0.09, -0.04, -0.02, 0.04, 0.05],[0.32, -0.01, -0.07, -0.08, -0.10, -0.02, 0.20, 0.02, 0.02, -0.15, 0.17],[0.20, 0.36, -0.13, -0.15, 0.03, -0.10, 0.23, 0.19, -0.20, -0.09, -0.19],[-0.10, 0.01, 0.00, -0.05, -0.06, 0.02, -0.03, 0.00, 0.39, -0.03, -0.15],[0.09, -0.04, -0.06, -0.12, -0.05, 0.02, -0.08, 0.04, 0.03, -0.03, 0.15]]},
+ {"i": 116,"j": 151, "score": 1.18, "iC": "DEKRHQNAL", "jC": "DEKRHQNSTAVI", "matrix": [[-0.41, -0.16, 0.14, 0.42, -0.03, -0.02, -0.10, 0.01, 0.16, 0.10, -0.00, -0.10],[-0.39, -0.45, 0.13, 0.41, 0.17, -0.09, 0.15, 0.01, 0.06, 0.05, -0.10, -0.01],[0.16, 0.30, -0.13, -0.20, -0.08, 0.10, 0.02, -0.12, -0.19, -0.03, 0.10, 0.01],[0.17, 0.07, -0.05, 0.03, -0.02, -0.06, -0.01, -0.02, -0.05, -0.04, 0.03, -0.01],[0.34, 0.19, -0.21, -0.63, -0.01, -0.22, -0.03, 0.71, 0.82, -0.34, -0.17, -0.06],[0.01, -0.04, -0.07, 0.08, 0.21, -0.05, -0.02, -0.09, -0.09, -0.06, 0.03, 0.04],[0.18, 0.01, 0.01, -0.06, -0.11, 0.08, 0.09, -0.09, -0.01, -0.07, -0.01, -0.02],[0.09, -0.05, -0.06, -0.10, -0.03, 0.05, 0.00, -0.17, 0.11, 0.23, -0.01, -0.01],[-0.12, 0.05, 0.06, 0.19, -0.06, -0.01, -0.05, -0.16, -0.21, -0.08, 0.17, 0.16]]},
+ {"i": 117,"j": 8, "score": 0.52, "iC": "DEKRHSTGAVILY", "jC": "DSTGA", "matrix": [[-0.02, 0.01, 0.01, 0.10, -0.17],[-0.17, -0.00, 0.07, 0.04, 0.06],[-0.20, 0.08, -0.00, -0.12, 0.09],[-0.10, 0.03, -0.01, -0.08, 0.18],[0.38, -0.14, -0.18, -0.03, -0.03],[-0.07, -0.05, 0.20, 0.09, -0.25],[0.17, 0.06, 0.36, -0.29, -0.25],[0.35, -0.21, -0.11, 0.02, 0.07],[-0.09, 0.02, -0.04, -0.04, 0.16],[-0.21, 0.23, -0.04, 0.14, -0.08],[-0.15, 0.22, 0.04, 0.00, -0.05],[0.07, -0.23, -0.14, -0.02, 0.32],[0.18, -0.01, -0.05, 0.04, -0.12]]},
+ {"i": 117,"j": 9, "score": 0.52, "iC": "EKRHQNTGAIL", "jC": "DEKRQNSPAL", "matrix": [[-0.16, -0.03, 0.21, 0.19, -0.03, -0.05, 0.03, -0.07, 0.01, -0.02],[-0.10, -0.04, -0.12, -0.15, 0.15, -0.20, 0.15, 0.26, 0.10, 0.09],[-0.04, -0.04, -0.24, -0.09, -0.00, -0.09, 0.16, 0.10, 0.15, -0.04],[-0.10, 0.25, 0.03, -0.05, -0.11, 0.04, -0.06, 0.01, -0.01, -0.08],[-0.01, -0.08, -0.15, -0.15, 0.08, -0.06, 0.04, 0.12, 0.14, 0.03],[0.05, -0.04, 0.03, -0.16, -0.08, 0.01, 0.05, -0.01, -0.05, 0.11],[0.15, -0.10, 0.02, 0.07, 0.06, 0.06, -0.07, -0.03, -0.10, 0.10],[0.41, 0.51, -0.15, -0.14, -0.17, -0.15, 0.16, -0.18, -0.06, -0.18],[-0.29, 0.08, -0.03, 0.12, 0.14, 0.07, -0.15, -0.15, 0.10, 0.15],[0.03, -0.17, 0.15, 0.04, -0.03, 0.04, 0.09, -0.04, -0.09, -0.04],[0.03, -0.05, 0.08, 0.10, 0.03, 0.19, -0.10, -0.11, -0.05, -0.08]]},
+ {"i": 117,"j": 115, "score": 0.48, "iC": "RHQTGL", "jC": "VI", "matrix": [[-0.15, 0.11],[-0.22, 0.26],[-0.08, 0.18],[0.17, -0.21],[0.55, -0.41],[0.02, -0.17]]},
+ {"i": 117,"j": 116, "score": 0.49, "iC": "EKHQNSTGAVILFY", "jC": "DEKHQNPGALY", "matrix": [[-0.16, -0.06, 0.05, 0.17, 0.03, -0.11, 0.09, -0.09, -0.04, 0.02, 0.07],[-0.14, 0.10, 0.06, -0.12, 0.07, -0.02, -0.06, -0.00, -0.13, 0.06, 0.21],[-0.04, -0.10, -0.18, 0.39, -0.11, 0.06, -0.04, -0.11, 0.05, 0.05, 0.04],[-0.21, -0.02, 0.01, 0.08, 0.02, 0.09, -0.03, 0.05, -0.01, 0.10, 0.02],[-0.20, 0.04, -0.06, 0.11, 0.06, -0.06, -0.01, 0.01, -0.05, 0.10, -0.02],[-0.15, -0.02, -0.04, -0.02, 0.06, -0.01, -0.04, -0.06, -0.03, 0.19, -0.09],[0.00, 0.04, -0.06, 0.08, 0.17, 0.01, -0.09, -0.04, -0.12, -0.05, -0.06],[-0.21, 0.21, 0.26, -0.31, 0.06, -0.12, 0.29, -0.12, 0.06, -0.09, -0.08],[0.29, -0.08, 0.01, 0.07, -0.07, -0.01, -0.18, -0.03, -0.10, -0.00, -0.01],[0.16, -0.10, -0.08, -0.05, 0.02, 0.05, -0.02, 0.16, 0.04, -0.03, -0.02],[0.17, 0.05, -0.07, -0.10, -0.05, 0.15, -0.02, 0.05, 0.01, -0.05, -0.03],[0.23, 0.01, 0.02, -0.34, -0.13, -0.01, 0.12, 0.05, 0.26, -0.10, -0.03],[0.17, -0.00, 0.01, -0.05, -0.03, -0.00, 0.02, 0.02, -0.02, -0.02, -0.02],[0.19, -0.03, -0.04, 0.02, -0.02, -0.01, -0.02, -0.02, 0.01, -0.02, -0.03]]},
+ {"i": 117,"j": 118, "score": 0.42, "iC": "DEKRHTGAV", "jC": "DEKNSTAVY", "matrix": [[-0.24, -0.19, 0.08, -0.12, 0.05, 0.22, 0.13, -0.03, 0.00],[-0.15, -0.24, 0.16, 0.18, 0.23, 0.04, -0.08, 0.00, -0.02],[0.06, 0.20, -0.03, 0.05, -0.09, -0.10, -0.00, -0.09, 0.15],[0.17, -0.06, 0.07, -0.08, -0.09, -0.00, 0.05, -0.03, -0.03],[-0.19, -0.03, -0.11, -0.01, 0.09, -0.15, 0.21, 0.08, 0.01],[-0.23, -0.06, -0.15, -0.17, 0.01, 0.20, -0.13, 0.41, -0.00],[0.10, 0.08, 0.16, 0.08, -0.26, -0.08, -0.14, 0.03, -0.06],[0.22, 0.23, -0.07, 0.03, -0.06, -0.04, -0.27, -0.03, -0.01],[0.03, 0.10, -0.05, -0.01, 0.17, -0.11, 0.02, -0.05, -0.02]]},
+ {"i": 117,"j": 119, "score": 1.61, "iC": "DEKRHQSTGAVILMFY", "jC": "KHTPAVILFY", "matrix": [[0.22, 0.00, -0.03, 0.29, -0.07, -0.19, -0.13, -0.06, 0.03, -0.03],[-0.01, -0.02, 0.03, -0.11, -0.02, -0.14, 0.03, -0.11, 0.35, -0.01],[-0.05, 0.02, -0.08, -0.27, -0.07, 0.01, 0.05, -0.16, 0.30, 0.41],[-0.03, -0.06, -0.03, -0.19, -0.05, -0.01, -0.15, -0.08, 0.22, 0.39],[-0.04, -0.04, -0.05, -0.19, 0.01, -0.22, -0.24, -0.05, 0.76, 0.02],[-0.03, -0.00, -0.02, -0.00, -0.11, -0.16, 0.02, -0.06, 0.31, 0.13],[-0.00, 0.06, 0.04, -0.05, 0.11, -0.07, 0.02, 0.01, -0.18, -0.18],[-0.02, -0.08, 0.06, -0.19, 0.21, 0.38, 0.22, 0.30, -0.58, -0.22],[-0.05, 0.31, -0.09, -0.18, -0.23, -0.40, -0.21, -0.15, 0.67, 0.48],[0.00, -0.14, -0.24, 0.34, -0.13, 0.00, 0.31, 0.18, -0.23, -0.23],[0.03, 0.02, 0.03, 0.05, 0.06, 0.26, 0.06, 0.18, -0.41, -0.21],[-0.01, -0.01, -0.01, 0.00, 0.06, 0.21, 0.05, 0.22, -0.32, -0.13],[0.02, -0.05, 0.34, 0.44, -0.08, 0.52, -0.07, -0.15, -0.59, -0.40],[-0.01, -0.01, 0.01, 0.06, 0.16, 0.13, 0.01, -0.05, -0.23, -0.09],[0.02, -0.01, 0.03, -0.03, 0.17, -0.06, -0.07, -0.03, -0.07, -0.06],[-0.02, -0.01, -0.02, -0.06, -0.03, -0.10, -0.03, -0.03, 0.00, 0.20]]},
+ {"i": 117,"j": 148, "score": 0.64, "iC": "DKRHQTGAL", "jC": "HAVILFWY", "matrix": [[0.17, 0.05, -0.03, -0.07, -0.01, -0.10, -0.05, -0.10],[-0.14, 0.07, 0.10, 0.16, 0.08, 0.04, -0.02, -0.31],[-0.11, -0.02, -0.03, -0.08, 0.10, -0.03, -0.06, -0.23],[-0.19, -0.06, -0.12, -0.12, -0.06, 0.12, 0.27, 0.50],[-0.11, -0.06, 0.11, 0.11, -0.02, -0.08, 0.01, -0.23],[-0.10, -0.05, -0.05, -0.05, 0.17, 0.36, 0.04, 0.09],[0.20, -0.09, 0.06, -0.05, -0.14, 0.02, -0.03, 0.10],[0.22, 0.01, 0.01, -0.15, 0.10, 0.11, 0.01, 0.41],[0.01, 0.24, 0.33, 0.19, -0.20, -0.28, -0.09, -0.28]]},
+ {"i": 118,"j": 8, "score": 0.49, "iC": "DRHNSAV", "jC": "DSTGA", "matrix": [[-0.42, -0.02, 0.20, 0.01, 0.29],[0.34, -0.11, -0.11, -0.03, -0.06],[0.06, 0.18, -0.00, -0.03, -0.25],[-0.26, 0.19, 0.06, -0.00, -0.03],[0.06, -0.21, -0.19, 0.38, 0.01],[0.18, -0.39, -0.02, 0.15, 0.04],[0.11, 0.22, -0.01, -0.16, -0.11]]},
+ {"i": 118,"j": 9, "score": 1.11, "iC": "DEKRHQSTPA", "jC": "DEKRQNSAL", "matrix": [[-0.16, -0.66, 0.15, 0.61, -0.06, 0.53, 0.05, -0.07, -0.29],[-0.28, -0.60, 0.53, 0.57, -0.29, -0.04, 0.02, -0.01, -0.06],[0.10, 0.40, -0.15, -0.10, 0.07, -0.15, -0.04, -0.02, 0.02],[-0.05, 0.33, -0.19, -0.34, 0.08, -0.03, 0.04, -0.10, 0.17],[0.07, 0.07, -0.13, -0.13, -0.09, -0.00, -0.04, -0.02, 0.17],[0.05, 0.08, -0.08, -0.15, 0.06, -0.11, 0.00, 0.05, 0.02],[0.20, 0.25, -0.01, -0.19, 0.05, 0.05, -0.09, 0.10, -0.14],[0.10, 0.15, -0.25, -0.19, 0.20, 0.09, -0.15, 0.16, 0.09],[-0.00, -0.05, -0.05, -0.17, -0.07, -0.01, 0.17, 0.04, 0.03],[-0.06, 0.06, 0.11, 0.01, -0.02, -0.23, 0.09, -0.06, 0.06]]},
+ {"i": 118,"j": 10, "score": 0.91, "iC": "DEKRHNSTA", "jC": "DEKRQNSTA", "matrix": [[-0.57, -0.21, 0.50, 0.18, -0.09, 0.02, 0.17, 0.12, -0.01],[-0.48, -0.30, 0.33, 0.07, -0.05, 0.23, 0.29, -0.19, -0.09],[0.30, 0.02, -0.14, -0.07, 0.03, -0.16, -0.05, 0.00, 0.01],[0.27, -0.04, -0.15, -0.02, -0.10, -0.30, 0.07, -0.02, 0.25],[0.32, 0.09, -0.06, -0.02, -0.07, -0.13, -0.06, -0.03, -0.10],[0.05, 0.16, -0.05, -0.05, 0.03, -0.10, 0.04, 0.03, -0.04],[0.25, 0.08, -0.15, -0.06, 0.13, 0.15, -0.09, -0.01, -0.13],[-0.06, 0.02, -0.10, -0.00, 0.19, -0.07, -0.15, 0.02, 0.18],[-0.01, -0.01, -0.08, -0.07, 0.08, 0.37, -0.06, 0.02, -0.16]]},
+ {"i": 118,"j": 117, "score": 0.42, "iC": "DEKNSTAVY", "jC": "DEKRHTGAV", "matrix": [[-0.24, -0.15, 0.06, 0.17, -0.19, -0.23, 0.10, 0.22, 0.03],[-0.19, -0.24, 0.20, -0.06, -0.03, -0.06, 0.08, 0.23, 0.10],[0.08, 0.16, -0.03, 0.07, -0.11, -0.15, 0.16, -0.07, -0.05],[-0.12, 0.18, 0.05, -0.08, -0.01, -0.17, 0.08, 0.03, -0.01],[0.05, 0.23, -0.09, -0.09, 0.09, 0.01, -0.26, -0.06, 0.17],[0.22, 0.04, -0.10, -0.00, -0.15, 0.20, -0.08, -0.04, -0.11],[0.13, -0.08, -0.00, 0.05, 0.21, -0.13, -0.14, -0.27, 0.02],[-0.03, 0.00, -0.09, -0.03, 0.08, 0.41, 0.03, -0.03, -0.05],[0.00, -0.02, 0.15, -0.03, 0.01, -0.00, -0.06, -0.01, -0.02]]},
+ {"i": 118,"j": 119, "score": 0.47, "iC": "DERNSTAV", "jC": "TPAVIF", "matrix": [[0.01, -0.65, 0.08, 0.04, 0.08, 0.06],[0.20, 0.04, 0.06, 0.05, -0.12, -0.07],[-0.03, 0.23, 0.00, 0.02, -0.15, -0.06],[0.00, -0.10, -0.01, -0.01, 0.16, 0.02],[-0.09, 0.47, -0.17, -0.23, -0.28, 0.16],[-0.05, 0.06, -0.04, -0.05, 0.16, -0.02],[-0.08, 0.27, -0.04, -0.00, -0.25, 0.15],[0.00, -0.16, 0.04, 0.11, 0.14, -0.06]]},
+ {"i": 119,"j": 8, "score": 1.02, "iC": "HPAVILFY", "jC": "DNSTGA", "matrix": [[0.31, -0.02, -0.08, -0.12, -0.03, -0.12],[-0.47, -0.09, -0.44, -0.21, 0.47, 0.54],[0.09, 0.03, -0.21, 0.15, 0.04, -0.01],[-0.11, 0.09, 0.16, -0.10, -0.35, 0.29],[-0.40, -0.04, 0.45, 0.21, -0.24, -0.09],[-0.20, -0.01, 0.08, 0.33, -0.14, -0.20],[0.51, -0.18, -0.09, -0.29, 0.19, 0.03],[0.28, -0.05, -0.02, 0.04, -0.19, 0.06]]},
+ {"i": 119,"j": 20, "score": 0.50, "iC": "KPVIF", "jC": "PIL", "matrix": [[-0.21, -0.04, 0.19],[-0.12, 0.15, -0.17],[0.47, -0.16, -0.31],[0.38, -0.25, -0.10],[-0.22, 0.07, 0.15]]},
+ {"i": 119,"j": 21, "score": 0.38, "iC": "PAF", "jC": "ACFWY", "matrix": [[-0.02, -0.03, -0.07, -0.12, 0.21],[-0.02, -0.04, 0.21, -0.07, -0.02],[0.17, 0.33, -0.32, 0.19, -0.28]]},
+ {"i": 119,"j": 115, "score": 0.41, "iC": "KTPGVFY", "jC": "VI", "matrix": [[-0.19, 0.20],[-0.14, 0.19],[0.38, -0.17],[0.18, -0.10],[0.10, -0.22],[-0.25, 0.23],[-0.31, 0.24]]},
+ {"i": 119,"j": 117, "score": 1.61, "iC": "KHTPAVILFY", "jC": "DEKRHQSTGAVILMFY", "matrix": [[0.22, -0.01, -0.05, -0.03, -0.04, -0.03, -0.00, -0.02, -0.05, 0.00, 0.03, -0.01, 0.02, -0.01, 0.02, -0.02],[0.00, -0.02, 0.02, -0.06, -0.04, -0.00, 0.06, -0.08, 0.31, -0.14, 0.02, -0.01, -0.05, -0.01, -0.01, -0.01],[-0.03, 0.03, -0.08, -0.03, -0.05, -0.02, 0.04, 0.06, -0.09, -0.24, 0.03, -0.01, 0.34, 0.01, 0.03, -0.02],[0.29, -0.11, -0.27, -0.19, -0.19, -0.00, -0.05, -0.19, -0.18, 0.34, 0.05, 0.00, 0.44, 0.06, -0.03, -0.06],[-0.07, -0.02, -0.07, -0.05, 0.01, -0.11, 0.11, 0.21, -0.23, -0.13, 0.06, 0.06, -0.08, 0.16, 0.17, -0.03],[-0.19, -0.14, 0.01, -0.01, -0.22, -0.16, -0.07, 0.38, -0.40, 0.00, 0.26, 0.21, 0.52, 0.13, -0.06, -0.10],[-0.13, 0.03, 0.05, -0.15, -0.24, 0.02, 0.02, 0.22, -0.21, 0.31, 0.06, 0.05, -0.07, 0.01, -0.07, -0.03],[-0.06, -0.11, -0.16, -0.08, -0.05, -0.06, 0.01, 0.30, -0.15, 0.18, 0.18, 0.22, -0.15, -0.05, -0.03, -0.03],[0.03, 0.35, 0.30, 0.22, 0.76, 0.31, -0.18, -0.58, 0.67, -0.23, -0.41, -0.32, -0.59, -0.23, -0.07, 0.00],[-0.03, -0.01, 0.41, 0.39, 0.02, 0.13, -0.18, -0.22, 0.48, -0.23, -0.21, -0.13, -0.40, -0.09, -0.06, 0.20]]},
+ {"i": 119,"j": 118, "score": 0.47, "iC": "TPAVIF", "jC": "DERNSTAV", "matrix": [[0.01, 0.20, -0.03, 0.00, -0.09, -0.05, -0.08, 0.00],[-0.65, 0.04, 0.23, -0.10, 0.47, 0.06, 0.27, -0.16],[0.08, 0.06, 0.00, -0.01, -0.17, -0.04, -0.04, 0.04],[0.04, 0.05, 0.02, -0.01, -0.23, -0.05, -0.00, 0.11],[0.08, -0.12, -0.15, 0.16, -0.28, 0.16, -0.25, 0.14],[0.06, -0.07, -0.06, 0.02, 0.16, -0.02, 0.15, -0.06]]},
+ {"i": 119,"j": 148, "score": 0.60, "iC": "PAVILFY", "jC": "EHPAVLFWY", "matrix": [[-0.05, -0.04, 0.01, 0.22, 0.06, -0.21, -0.00, -0.09, -0.19],[0.00, -0.04, 0.13, -0.05, -0.03, 0.12, -0.10, -0.04, -0.18],[0.13, 0.22, -0.10, 0.03, -0.01, -0.17, 0.15, -0.05, 0.04],[-0.02, -0.08, -0.02, -0.11, -0.17, -0.01, 0.27, 0.03, 0.24],[-0.00, -0.04, -0.04, -0.11, -0.11, 0.02, 0.05, -0.00, 0.42],[-0.17, 0.04, -0.24, -0.17, 0.03, -0.00, 0.15, 0.20, 0.41],[0.13, -0.05, 0.14, 0.13, 0.37, -0.07, -0.40, -0.03, -0.43]]},
+ {"i": 120,"j": 15, "score": 1.18, "iC": "DEKRQSTPGA", "jC": "DKRHNAILFY", "matrix": [[-0.09, 0.94, 0.62, -0.27, -0.11, -0.18, -0.06, -0.33, -0.13, -0.33],[-0.24, 0.35, 0.28, 0.04, 0.21, -0.19, -0.01, 0.11, 0.03, -0.37],[0.08, -0.40, -0.15, 0.03, -0.08, -0.08, 0.16, 0.23, 0.03, 0.27],[0.15, -0.20, -0.15, 0.01, -0.01, 0.01, -0.03, 0.02, -0.03, 0.00],[0.01, -0.33, -0.09, 0.15, -0.11, 0.13, -0.00, 0.05, 0.25, 0.07],[0.25, -0.19, -0.08, -0.09, 0.02, 0.08, 0.02, -0.07, -0.10, -0.00],[0.04, -0.16, -0.06, -0.01, 0.04, 0.05, 0.05, -0.09, -0.04, 0.00],[-0.05, -0.24, -0.11, 0.16, 0.07, 0.10, -0.15, 0.03, 0.05, 0.29],[-0.06, 0.54, 0.12, -0.05, -0.11, -0.06, -0.09, -0.11, 0.00, -0.15],[-0.02, -0.16, -0.15, -0.05, 0.12, 0.14, 0.08, 0.03, -0.04, -0.17]]},
+ {"i": 121,"j": 8, "score": 0.48, "iC": "GAC", "jC": "DSTGAC", "matrix": [[-0.26, 0.21, 0.16, -0.33, 0.38, -0.13],[0.05, -0.18, -0.12, 0.45, 0.01, -0.06],[0.21, -0.16, 0.07, -0.07, -0.12, 0.17]]},
+ {"i": 121,"j": 12, "score": 2.15, "iC": "GAVC", "jC": "ETGAVILC", "matrix": [[-0.46, 0.29, -1.33, -0.63, 1.08, 0.37, 0.42, 0.16],[0.50, -0.16, 0.23, 0.93, -0.89, -0.31, -0.35, -0.17],[0.01, -0.02, 0.22, -0.01, -0.07, -0.05, -0.06, -0.02],[-0.02, -0.04, 0.70, -0.19, -0.24, -0.07, -0.10, 0.07]]},
+ {"i": 121,"j": 20, "score": 0.39, "iC": "GAC", "jC": "PL", "matrix": [[0.23, -0.30],[-0.38, 0.40],[0.17, -0.17]]},
+ {"i": 121,"j": 124, "score": 0.37, "iC": "GAVC", "jC": "RFWY", "matrix": [[0.12, -0.11, -0.16, -0.02],[-0.19, 0.47, 0.19, 0.00],[0.02, -0.26, 0.02, 0.22],[-0.02, 0.31, -0.10, -0.11]]},
+ {"i": 122,"j": 17, "score": 0.38, "iC": "D", "jC": "NTG", "matrix": [[0.22, -0.15, 0.43]]},
+ {"i": 122,"j": 123, "score": 0.67, "iC": "DNT", "jC": "TVI", "matrix": [[0.61, -0.53, -0.20],[-0.22, 0.15, 0.18],[-0.20, 0.11, -0.03]]},
+ {"i": 123,"j": 97, "score": 0.77, "iC": "KRSTAV", "jC": "DEKRSG", "matrix": [[-0.02, 0.25, -0.03, -0.02, -0.01, -0.17],[0.01, 0.24, -0.04, -0.02, -0.00, -0.31],[0.13, -0.07, -0.04, -0.02, 0.32, -0.17],[-0.16, -0.24, -0.05, -0.07, -0.04, 0.55],[0.07, 0.38, -0.09, -0.10, -0.15, -0.41],[-0.06, -0.40, 0.17, 0.18, -0.20, 0.34]]},
+ {"i": 123,"j": 122, "score": 0.67, "iC": "TVI", "jC": "DNT", "matrix": [[0.61, -0.22, -0.20],[-0.53, 0.15, 0.11],[-0.20, 0.18, -0.03]]},
+ {"i": 123,"j": 124, "score": 0.39, "iC": "TAV", "jC": "RHQTFWY", "matrix": [[0.10, -0.15, 0.19, -0.23, -0.02, 0.24, -0.09],[-0.18, 0.16, -0.17, -0.17, 0.26, 0.21, 0.06],[0.07, 0.02, -0.04, 0.30, -0.02, -0.33, -0.22]]},
+ {"i": 124,"j": 12, "score": 1.11, "iC": "KRHQSTAVLFWY", "jC": "TGAVILC", "matrix": [[0.02, -0.12, -0.15, -0.09, 0.07, -0.16, -0.01],[-0.03, -0.04, -0.20, 0.07, 0.15, -0.02, -0.03],[0.18, 0.11, -0.05, 0.01, -0.23, 0.15, -0.03],[0.14, 0.02, -0.03, -0.27, 0.16, -0.05, -0.02],[0.02, -0.00, -0.10, -0.31, 0.44, -0.06, 0.00],[0.02, -0.08, -0.17, 0.14, 0.09, -0.08, -0.03],[-0.02, -0.04, -0.02, -0.16, 0.08, 0.01, -0.01],[0.00, -0.05, -0.13, 0.20, 0.10, -0.09, -0.03],[-0.04, -0.04, -0.08, 0.21, 0.04, -0.07, -0.03],[-0.05, 0.50, 0.71, -0.11, -0.60, -0.35, 0.29],[-0.08, -0.08, 0.17, 0.03, -0.11, 0.23, -0.04],[-0.19, -0.17, 0.21, 0.07, -0.17, 0.55, -0.04]]},
+ {"i": 124,"j": 121, "score": 0.37, "iC": "RFWY", "jC": "GAVC", "matrix": [[0.12, -0.19, 0.02, -0.02],[-0.11, 0.47, -0.26, 0.31],[-0.16, 0.19, 0.02, -0.10],[-0.02, 0.00, 0.22, -0.11]]},
+ {"i": 124,"j": 123, "score": 0.39, "iC": "RHQTFWY", "jC": "TAV", "matrix": [[0.10, -0.18, 0.07],[-0.15, 0.16, 0.02],[0.19, -0.17, -0.04],[-0.23, -0.17, 0.30],[-0.02, 0.26, -0.02],[0.24, 0.21, -0.33],[-0.09, 0.06, -0.22]]},
+ {"i": 125,"j": 3, "score": 0.54, "iC": "MFY", "jC": "HSAILMF", "matrix": [[-0.03, 0.00, -0.23, 0.01, -0.03, -0.17, 0.28],[-0.40, -0.17, 0.22, 0.34, 0.21, -0.06, -0.11],[0.52, 0.13, -0.11, -0.17, -0.22, -0.07, -0.08]]},
+ {"i": 125,"j": 5, "score": 0.66, "iC": "AVLMF", "jC": "AVLFWY", "matrix": [[-0.23, -0.33, -0.03, 0.12, 0.37, 0.08],[-0.10, -0.20, 0.23, 0.04, -0.01, 0.07],[0.00, 0.21, 0.01, -0.01, -0.16, -0.08],[-0.13, -0.07, -0.10, -0.01, 0.13, 0.20],[0.41, 0.37, -0.09, -0.19, -0.35, -0.30]]},
+ {"i": 125,"j": 7, "score": 0.45, "iC": "AMF", "jC": "ERQTAVM", "matrix": [[0.21, 0.03, 0.40, -0.03, -0.05, -0.22, -0.14],[0.18, 0.07, 0.03, -0.06, -0.01, -0.08, 0.01],[-0.26, -0.24, -0.34, 0.20, -0.18, 0.27, 0.24]]},
+ {"i": 125,"j": 110, "score": 0.44, "iC": "VLFY", "jC": "QAVILM", "matrix": [[0.00, -0.01, 0.15, 0.02, -0.13, -0.06],[-0.03, 0.19, -0.06, -0.26, 0.09, -0.04],[-0.22, -0.30, -0.08, 0.07, 0.30, 0.40],[0.24, -0.05, 0.01, -0.08, -0.18, 0.01]]},
+ {"i": 125,"j": 126, "score": 0.85, "iC": "AVILMF", "jC": "DESPV", "matrix": [[-0.06, -0.04, -0.02, 0.33, -0.02],[0.14, -0.02, -0.01, -0.30, -0.02],[0.12, 0.06, 0.11, -0.26, -0.02],[0.12, 0.15, 0.11, -0.58, -0.04],[-0.09, -0.03, -0.01, -0.02, 0.16],[-0.15, -0.15, -0.17, 0.72, -0.05]]},
+ {"i": 126,"j": 101, "score": 0.40, "iC": "EKP", "jC": "DKNSA", "matrix": [[-0.05, 0.29, -0.02, -0.04, -0.17],[0.16, -0.11, 0.08, -0.02, -0.05],[-0.38, -0.03, -0.22, 0.22, 0.22]]},
+ {"i": 126,"j": 125, "score": 0.85, "iC": "DESPV", "jC": "AVILMF", "matrix": [[-0.06, 0.14, 0.12, 0.12, -0.09, -0.15],[-0.04, -0.02, 0.06, 0.15, -0.03, -0.15],[-0.02, -0.01, 0.11, 0.11, -0.01, -0.17],[0.33, -0.30, -0.26, -0.58, -0.02, 0.72],[-0.02, -0.02, -0.02, -0.04, 0.16, -0.05]]},
+ {"i": 126,"j": 127, "score": 0.40, "iC": "DPI", "jC": "DEKRNSPVI", "matrix": [[-0.23, -0.05, -0.04, -0.02, -0.02, 0.01, -0.07, 0.01, -0.00],[0.01, 0.46, 0.16, 0.15, -0.16, 0.21, -0.22, 0.16, -0.17],[0.02, -0.06, -0.04, -0.01, -0.00, 0.00, 0.19, -0.01, -0.01]]},
+ {"i": 127,"j": 11, "score": 0.63, "iC": "DEKRNTAVL", "jC": "DKRQNGLMFWY", "matrix": [[-0.10, 0.20, 0.15, -0.15, 0.15, 0.09, -0.09, -0.16, -0.05, 0.08, -0.12],[-0.20, 0.06, 0.70, -0.06, 0.21, -0.21, -0.10, -0.06, -0.16, -0.13, -0.12],[0.15, -0.11, -0.35, 0.01, -0.08, 0.05, 0.02, 0.05, 0.08, 0.02, 0.23],[0.01, 0.03, -0.19, -0.02, -0.05, -0.05, 0.00, 0.11, 0.08, 0.04, 0.05],[-0.04, 0.07, -0.15, -0.02, -0.01, -0.12, 0.06, 0.10, 0.05, 0.25, -0.09],[-0.02, -0.02, -0.19, 0.12, 0.04, 0.10, -0.02, -0.04, -0.04, -0.06, 0.06],[0.08, -0.06, -0.04, 0.07, -0.12, -0.13, 0.19, 0.02, -0.10, 0.04, 0.01],[-0.04, -0.03, 0.14, 0.12, -0.01, -0.23, -0.02, 0.02, 0.04, -0.04, -0.03],[-0.02, -0.02, -0.01, -0.03, 0.01, 0.21, -0.02, 0.01, 0.01, -0.04, -0.02]]},
+ {"i": 127,"j": 126, "score": 0.40, "iC": "DEKRNSPVI", "jC": "DPI", "matrix": [[-0.23, 0.01, 0.02],[-0.05, 0.46, -0.06],[-0.04, 0.16, -0.04],[-0.02, 0.15, -0.01],[-0.02, -0.16, -0.00],[0.01, 0.21, 0.00],[-0.07, -0.22, 0.19],[0.01, 0.16, -0.01],[-0.00, -0.17, -0.01]]},
+ {"i": 127,"j": 128, "score": 0.42, "iC": "DEKQNSPL", "jC": "SPILFY", "matrix": [[-0.07, 0.07, -0.30, -0.09, 0.21, 0.47],[0.01, -0.15, 0.17, 0.05, -0.12, -0.20],[0.02, -0.05, 0.11, -0.06, 0.03, -0.19],[0.01, 0.04, 0.11, 0.06, -0.20, -0.11],[-0.03, -0.05, -0.14, 0.19, 0.13, 0.04],[-0.02, -0.07, -0.02, 0.01, 0.21, 0.09],[-0.02, -0.28, 0.23, 0.11, -0.02, 0.10],[0.19, 0.08, -0.16, -0.16, -0.17, -0.09]]},
+ {"i": 127,"j": 129, "score": 0.48, "iC": "DETPAL", "jC": "DEKRQNSPL", "matrix": [[-0.39, -0.12, -0.06, 0.29, 0.21, -0.22, 0.33, -0.22, 0.25],[-0.10, -0.36, 0.23, 0.20, -0.13, -0.01, -0.00, 0.08, -0.15],[0.20, -0.06, -0.01, -0.04, -0.02, -0.08, -0.00, 0.01, -0.02],[-0.10, 0.20, 0.04, -0.05, -0.05, -0.03, 0.06, 0.11, -0.05],[0.14, 0.15, -0.01, -0.16, -0.10, 0.08, -0.04, -0.05, -0.05],[-0.18, 0.03, 0.04, -0.06, -0.01, -0.11, -0.08, 0.10, 0.23]]},
+ {"i": 128,"j": 7, "score": 0.49, "iC": "PILFY", "jC": "ERHQTILMY", "matrix": [[-0.04, 0.26, 0.00, 0.01, 0.08, -0.04, -0.03, -0.10, -0.02],[0.23, -0.29, -0.17, 0.13, -0.06, 0.11, -0.11, 0.04, -0.13],[0.05, 0.07, -0.07, 0.17, 0.03, -0.10, -0.15, -0.19, 0.15],[-0.21, 0.35, -0.18, -0.07, -0.16, 0.16, 0.08, 0.39, -0.01],[-0.08, -0.11, 0.56, -0.09, 0.03, 0.01, 0.16, -0.22, -0.09]]},
+ {"i": 128,"j": 11, "score": 0.37, "iC": "PVILFWY", "jC": "RNGWY", "matrix": [[-0.19, -0.07, 0.22, 0.02, 0.07],[-0.15, -0.03, 0.14, -0.07, -0.05],[-0.19, 0.26, -0.06, 0.01, -0.07],[0.09, 0.12, -0.23, 0.29, -0.00],[0.07, -0.01, -0.24, -0.06, 0.22],[0.19, -0.10, -0.04, -0.06, -0.03],[0.47, -0.13, -0.26, -0.09, -0.07]]},
+ {"i": 128,"j": 104, "score": 0.43, "iC": "VILFY", "jC": "KLMFW", "matrix": [[-0.05, 0.08, 0.22, -0.13, 0.05],[-0.15, -0.16, 0.47, -0.08, 0.10],[0.18, 0.15, -0.36, -0.08, -0.03],[0.07, 0.08, -0.28, 0.24, -0.16],[-0.03, -0.02, 0.21, -0.06, -0.09]]},
+ {"i": 128,"j": 110, "score": 1.26, "iC": "PVILMFWY", "jC": "AVILMC", "matrix": [[-0.07, -0.12, 0.15, 0.02, -0.04, 0.04],[-0.17, -0.12, 0.04, 0.24, 0.19, -0.07],[-0.21, -0.20, 0.46, 0.54, -0.24, -0.15],[0.39, 0.70, 0.08, -0.74, -0.61, 0.21],[0.15, 0.23, -0.03, -0.21, -0.08, 0.01],[0.01, -0.22, -0.02, 0.06, 0.31, -0.10],[-0.08, -0.16, -0.36, 0.09, 0.40, 0.03],[-0.09, -0.15, -0.40, 0.33, 0.25, -0.02]]},
+ {"i": 128,"j": 127, "score": 0.42, "iC": "SPILFY", "jC": "DEKQNSPL", "matrix": [[-0.07, 0.01, 0.02, 0.01, -0.03, -0.02, -0.02, 0.19],[0.07, -0.15, -0.05, 0.04, -0.05, -0.07, -0.28, 0.08],[-0.30, 0.17, 0.11, 0.11, -0.14, -0.02, 0.23, -0.16],[-0.09, 0.05, -0.06, 0.06, 0.19, 0.01, 0.11, -0.16],[0.21, -0.12, 0.03, -0.20, 0.13, 0.21, -0.02, -0.17],[0.47, -0.20, -0.19, -0.11, 0.04, 0.09, 0.10, -0.09]]},
+ {"i": 128,"j": 129, "score": 0.59, "iC": "ESVILFWY", "jC": "DERQNSPGAL", "matrix": [[-0.16, 0.02, 0.01, 0.02, 0.02, -0.02, -0.03, 0.00, 0.06, 0.01],[-0.05, -0.02, -0.03, -0.01, -0.03, -0.03, -0.03, -0.01, -0.02, 0.16],[0.22, -0.12, -0.01, -0.02, 0.25, -0.12, 0.07, -0.15, -0.02, 0.06],[0.25, -0.19, -0.16, -0.07, 0.16, -0.04, 0.38, -0.01, -0.13, -0.16],[0.02, -0.14, -0.24, -0.07, 0.01, 0.03, 0.35, 0.25, 0.10, -0.25],[0.19, 0.27, 0.10, -0.12, -0.04, 0.24, -0.22, -0.14, 0.12, 0.01],[0.02, 0.01, 0.16, 0.04, 0.14, -0.15, -0.08, 0.05, -0.17, -0.04],[-0.17, 0.22, 0.09, 0.20, -0.17, 0.10, -0.21, -0.09, -0.02, -0.00]]},
+ {"i": 128,"j": 130, "score": 0.76, "iC": "EPVILFWY", "jC": "EKRTPALMFWY", "matrix": [[-0.05, 0.02, -0.03, -0.01, 0.02, -0.03, 0.19, 0.01, 0.00, -0.02, -0.01],[-0.07, 0.01, -0.08, -0.01, 0.24, -0.05, 0.09, 0.05, -0.01, -0.06, -0.02],[-0.16, -0.05, -0.12, -0.07, -0.08, -0.17, 0.16, 0.05, 0.18, 0.57, 0.23],[-0.02, -0.22, -0.15, -0.02, 0.25, 0.07, -0.09, -0.11, 0.18, 0.22, 0.34],[0.03, -0.06, -0.35, 0.05, 0.03, 0.19, -0.13, 0.18, -0.09, 0.02, -0.06],[0.16, 0.13, 0.36, 0.18, -0.24, -0.00, -0.18, -0.06, -0.25, -0.29, -0.12],[0.22, 0.15, 0.36, 0.00, -0.05, -0.15, -0.26, -0.08, -0.13, -0.16, -0.11],[0.08, 0.07, 0.01, 0.01, -0.10, 0.20, -0.18, -0.11, -0.03, -0.28, -0.20]]},
+ {"i": 128,"j": 155, "score": 0.38, "iC": "VIFY", "jC": "LFWY", "matrix": [[-0.27, 0.18, -0.10, 0.20],[-0.13, 0.05, 0.02, 0.22],[-0.00, -0.29, 0.20, -0.03],[0.45, 0.06, -0.16, -0.33]]},
+ {"i": 129,"j": 127, "score": 0.48, "iC": "DEKRQNSPL", "jC": "DETPAL", "matrix": [[-0.39, -0.10, 0.20, -0.10, 0.14, -0.18],[-0.12, -0.36, -0.06, 0.20, 0.15, 0.03],[-0.06, 0.23, -0.01, 0.04, -0.01, 0.04],[0.29, 0.20, -0.04, -0.05, -0.16, -0.06],[0.21, -0.13, -0.02, -0.05, -0.10, -0.01],[-0.22, -0.01, -0.08, -0.03, 0.08, -0.11],[0.33, -0.00, -0.00, 0.06, -0.04, -0.08],[-0.22, 0.08, 0.01, 0.11, -0.05, 0.10],[0.25, -0.15, -0.02, -0.05, -0.05, 0.23]]},
+ {"i": 129,"j": 128, "score": 0.59, "iC": "DERQNSPGAL", "jC": "ESVILFWY", "matrix": [[-0.16, -0.05, 0.22, 0.25, 0.02, 0.19, 0.02, -0.17],[0.02, -0.02, -0.12, -0.19, -0.14, 0.27, 0.01, 0.22],[0.01, -0.03, -0.01, -0.16, -0.24, 0.10, 0.16, 0.09],[0.02, -0.01, -0.02, -0.07, -0.07, -0.12, 0.04, 0.20],[0.02, -0.03, 0.25, 0.16, 0.01, -0.04, 0.14, -0.17],[-0.02, -0.03, -0.12, -0.04, 0.03, 0.24, -0.15, 0.10],[-0.03, -0.03, 0.07, 0.38, 0.35, -0.22, -0.08, -0.21],[0.00, -0.01, -0.15, -0.01, 0.25, -0.14, 0.05, -0.09],[0.06, -0.02, -0.02, -0.13, 0.10, 0.12, -0.17, -0.02],[0.01, 0.16, 0.06, -0.16, -0.25, 0.01, -0.04, -0.00]]},
+ {"i": 129,"j": 130, "score": 0.66, "iC": "DEKQNSPGA", "jC": "DEKRHNSTPGAMFWY", "matrix": [[-0.27, 0.06, -0.01, 0.36, -0.18, -0.16, -0.28, 0.15, 0.04, -0.31, -0.08, 0.20, 0.23, 0.09, 0.21],[-0.04, -0.22, 0.31, -0.04, 0.10, 0.00, 0.11, -0.00, 0.05, 0.12, -0.10, -0.02, -0.10, 0.02, -0.07],[0.09, 0.16, -0.08, -0.05, 0.06, 0.02, 0.07, -0.05, -0.10, -0.01, 0.09, 0.05, -0.08, -0.04, -0.05],[-0.03, -0.08, 0.15, 0.02, 0.02, -0.01, -0.06, -0.01, -0.09, 0.00, 0.12, -0.02, -0.01, -0.06, -0.01],[-0.12, -0.04, -0.09, 0.14, 0.01, -0.10, -0.17, -0.17, 0.09, -0.07, -0.21, 0.03, 0.12, 0.26, 0.33],[0.10, 0.09, -0.01, -0.03, -0.03, 0.07, -0.05, 0.07, -0.05, 0.02, 0.01, 0.00, -0.07, -0.18, -0.10],[0.02, 0.13, -0.13, -0.12, -0.03, 0.13, 0.08, -0.03, -0.18, 0.11, 0.28, -0.03, -0.06, 0.12, -0.16],[0.08, 0.11, -0.07, -0.06, -0.04, 0.04, 0.00, 0.11, 0.37, -0.18, -0.15, -0.05, -0.06, -0.09, 0.06],[0.07, -0.09, -0.05, -0.08, 0.07, 0.02, 0.18, -0.03, -0.24, -0.01, 0.06, -0.02, -0.05, -0.01, 0.01]]},
+ {"i": 129,"j": 131, "score": 1.17, "iC": "DEKNSPG", "jC": "DEKRHNSTGAVILF", "matrix": [[-0.64, -0.70, 0.31, 0.31, -0.08, 0.33, 0.63, 0.49, -0.19, 0.39, -0.16, -0.15, -0.02, -0.08],[-0.02, -0.12, -0.06, 0.07, -0.00, 0.01, 0.04, -0.04, -0.09, -0.04, 0.15, 0.10, 0.11, -0.13],[0.18, 0.11, -0.06, -0.00, -0.02, -0.13, -0.06, 0.04, -0.03, -0.06, -0.04, 0.03, 0.09, 0.03],[0.26, -0.12, 0.12, -0.04, -0.02, 0.02, -0.03, -0.18, -0.02, 0.11, 0.01, -0.01, -0.05, -0.04],[-0.03, 0.19, 0.07, -0.08, -0.06, -0.23, -0.13, 0.11, -0.13, -0.06, -0.10, 0.01, -0.02, 0.18],[-0.05, -0.01, -0.14, -0.01, 0.17, 0.02, -0.10, 0.01, 0.23, 0.10, 0.07, 0.00, -0.17, 0.08],[0.09, 0.66, -0.07, -0.05, -0.01, -0.08, -0.26, -0.17, 0.30, -0.27, -0.04, -0.03, -0.07, -0.01]]},
+ {"i": 129,"j": 132, "score": 1.04, "iC": "DEKNSPGL", "jC": "DEKRQNSGAVILFW", "matrix": [[-0.57, -0.48, 0.51, 0.26, 0.32, -0.05, 0.05, -0.28, 0.20, 0.36, 0.40, 0.34, -0.35, -0.12],[-0.12, -0.25, -0.06, 0.13, -0.04, -0.02, -0.07, 0.06, 0.10, 0.03, 0.00, -0.01, 0.29, 0.04],[0.11, 0.21, -0.05, 0.00, -0.03, -0.04, -0.03, -0.04, -0.09, -0.05, -0.02, 0.03, -0.01, -0.02],[0.43, 0.50, -0.17, -0.11, -0.09, 0.24, -0.04, -0.07, -0.02, -0.07, -0.02, -0.04, -0.12, -0.05],[0.17, 0.16, -0.06, -0.02, -0.05, 0.05, 0.01, -0.01, -0.04, -0.17, -0.08, 0.03, -0.03, -0.05],[-0.18, 0.09, -0.02, -0.10, 0.13, -0.05, -0.02, -0.11, -0.02, -0.06, -0.11, 0.02, 0.36, -0.07],[-0.12, -0.17, -0.07, -0.12, -0.10, -0.05, -0.06, -0.08, -0.18, -0.09, -0.06, -0.08, -0.10, 0.31],[-0.08, -0.03, -0.02, -0.04, -0.01, 0.02, 0.16, 0.18, -0.04, -0.05, -0.03, -0.04, 0.01, -0.01]]},
+ {"i": 130,"j": 114, "score": 0.48, "iC": "EKRPLFWY", "jC": "EKRHLFY", "matrix": [[-0.22, 0.26, 0.26, -0.21, 0.06, -0.04, 0.04],[0.33, -0.21, -0.20, -0.10, -0.03, 0.18, 0.02],[0.63, -0.05, -0.23, -0.15, -0.16, -0.01, -0.03],[0.01, -0.06, -0.08, 0.32, -0.07, -0.19, 0.02],[0.01, -0.05, 0.03, -0.06, -0.01, -0.09, 0.19],[-0.19, -0.06, -0.01, -0.06, 0.03, 0.18, -0.06],[-0.27, 0.21, 0.17, 0.20, -0.04, 0.12, -0.13],[-0.09, 0.15, -0.19, -0.06, -0.02, -0.01, -0.01]]},
+ {"i": 130,"j": 128, "score": 0.76, "iC": "EKRTPALMFWY", "jC": "EPVILFWY", "matrix": [[-0.05, -0.07, -0.16, -0.02, 0.03, 0.16, 0.22, 0.08],[0.02, 0.01, -0.05, -0.22, -0.06, 0.13, 0.15, 0.07],[-0.03, -0.08, -0.12, -0.15, -0.35, 0.36, 0.36, 0.01],[-0.01, -0.01, -0.07, -0.02, 0.05, 0.18, 0.00, 0.01],[0.02, 0.24, -0.08, 0.25, 0.03, -0.24, -0.05, -0.10],[-0.03, -0.05, -0.17, 0.07, 0.19, -0.00, -0.15, 0.20],[0.19, 0.09, 0.16, -0.09, -0.13, -0.18, -0.26, -0.18],[0.01, 0.05, 0.05, -0.11, 0.18, -0.06, -0.08, -0.11],[0.00, -0.01, 0.18, 0.18, -0.09, -0.25, -0.13, -0.03],[-0.02, -0.06, 0.57, 0.22, 0.02, -0.29, -0.16, -0.28],[-0.01, -0.02, 0.23, 0.34, -0.06, -0.12, -0.11, -0.20]]},
+ {"i": 130,"j": 129, "score": 0.66, "iC": "DEKRHNSTPGAMFWY", "jC": "DEKQNSPGA", "matrix": [[-0.27, -0.04, 0.09, -0.03, -0.12, 0.10, 0.02, 0.08, 0.07],[0.06, -0.22, 0.16, -0.08, -0.04, 0.09, 0.13, 0.11, -0.09],[-0.01, 0.31, -0.08, 0.15, -0.09, -0.01, -0.13, -0.07, -0.05],[0.36, -0.04, -0.05, 0.02, 0.14, -0.03, -0.12, -0.06, -0.08],[-0.18, 0.10, 0.06, 0.02, 0.01, -0.03, -0.03, -0.04, 0.07],[-0.16, 0.00, 0.02, -0.01, -0.10, 0.07, 0.13, 0.04, 0.02],[-0.28, 0.11, 0.07, -0.06, -0.17, -0.05, 0.08, 0.00, 0.18],[0.15, -0.00, -0.05, -0.01, -0.17, 0.07, -0.03, 0.11, -0.03],[0.04, 0.05, -0.10, -0.09, 0.09, -0.05, -0.18, 0.37, -0.24],[-0.31, 0.12, -0.01, 0.00, -0.07, 0.02, 0.11, -0.18, -0.01],[-0.08, -0.10, 0.09, 0.12, -0.21, 0.01, 0.28, -0.15, 0.06],[0.20, -0.02, 0.05, -0.02, 0.03, 0.00, -0.03, -0.05, -0.02],[0.23, -0.10, -0.08, -0.01, 0.12, -0.07, -0.06, -0.06, -0.05],[0.09, 0.02, -0.04, -0.06, 0.26, -0.18, 0.12, -0.09, -0.01],[0.21, -0.07, -0.05, -0.01, 0.33, -0.10, -0.16, 0.06, 0.01]]},
+ {"i": 130,"j": 131, "score": 0.63, "iC": "DEKRHPALFWY", "jC": "DEKNSTGAVL", "matrix": [[-0.15, -0.23, 0.10, -0.07, -0.08, -0.05, 0.14, -0.02, -0.05, 0.02],[-0.18, -0.26, 0.19, -0.10, 0.05, 0.23, 0.16, 0.02, -0.09, -0.08],[-0.02, 0.24, -0.03, 0.05, -0.03, -0.01, -0.06, -0.07, -0.04, 0.05],[0.07, 0.06, 0.02, 0.07, 0.13, 0.05, -0.08, -0.16, 0.02, -0.07],[0.03, -0.16, -0.03, -0.08, -0.04, -0.02, -0.08, 0.04, -0.00, 0.36],[-0.16, 0.40, -0.06, -0.11, -0.41, -0.18, -0.05, 0.42, 0.27, 0.06],[0.16, -0.10, -0.12, -0.07, -0.13, -0.16, 0.13, 0.07, 0.04, -0.07],[-0.04, 0.07, 0.02, 0.19, 0.19, 0.05, -0.16, 0.14, -0.03, -0.03],[-0.07, 0.12, 0.06, -0.09, 0.26, -0.02, 0.03, 0.04, -0.03, -0.04],[0.02, -0.01, -0.08, 0.07, 0.24, 0.04, -0.04, -0.15, -0.02, -0.09],[0.09, -0.06, -0.02, -0.09, 0.23, -0.02, -0.01, -0.05, -0.03, -0.02]]},
+ {"i": 131,"j": 129, "score": 1.17, "iC": "DEKRHNSTGAVILF", "jC": "DEKNSPG", "matrix": [[-0.64, -0.02, 0.18, 0.26, -0.03, -0.05, 0.09],[-0.70, -0.12, 0.11, -0.12, 0.19, -0.01, 0.66],[0.31, -0.06, -0.06, 0.12, 0.07, -0.14, -0.07],[0.31, 0.07, -0.00, -0.04, -0.08, -0.01, -0.05],[-0.08, -0.00, -0.02, -0.02, -0.06, 0.17, -0.01],[0.33, 0.01, -0.13, 0.02, -0.23, 0.02, -0.08],[0.63, 0.04, -0.06, -0.03, -0.13, -0.10, -0.26],[0.49, -0.04, 0.04, -0.18, 0.11, 0.01, -0.17],[-0.19, -0.09, -0.03, -0.02, -0.13, 0.23, 0.30],[0.39, -0.04, -0.06, 0.11, -0.06, 0.10, -0.27],[-0.16, 0.15, -0.04, 0.01, -0.10, 0.07, -0.04],[-0.15, 0.10, 0.03, -0.01, 0.01, 0.00, -0.03],[-0.02, 0.11, 0.09, -0.05, -0.02, -0.17, -0.07],[-0.08, -0.13, 0.03, -0.04, 0.18, 0.08, -0.01]]},
+ {"i": 131,"j": 130, "score": 0.63, "iC": "DEKNSTGAVL", "jC": "DEKRHPALFWY", "matrix": [[-0.15, -0.18, -0.02, 0.07, 0.03, -0.16, 0.16, -0.04, -0.07, 0.02, 0.09],[-0.23, -0.26, 0.24, 0.06, -0.16, 0.40, -0.10, 0.07, 0.12, -0.01, -0.06],[0.10, 0.19, -0.03, 0.02, -0.03, -0.06, -0.12, 0.02, 0.06, -0.08, -0.02],[-0.07, -0.10, 0.05, 0.07, -0.08, -0.11, -0.07, 0.19, -0.09, 0.07, -0.09],[-0.08, 0.05, -0.03, 0.13, -0.04, -0.41, -0.13, 0.19, 0.26, 0.24, 0.23],[-0.05, 0.23, -0.01, 0.05, -0.02, -0.18, -0.16, 0.05, -0.02, 0.04, -0.02],[0.14, 0.16, -0.06, -0.08, -0.08, -0.05, 0.13, -0.16, 0.03, -0.04, -0.01],[-0.02, 0.02, -0.07, -0.16, 0.04, 0.42, 0.07, 0.14, 0.04, -0.15, -0.05],[-0.05, -0.09, -0.04, 0.02, -0.00, 0.27, 0.04, -0.03, -0.03, -0.02, -0.03],[0.02, -0.08, 0.05, -0.07, 0.36, 0.06, -0.07, -0.03, -0.04, -0.09, -0.02]]},
+ {"i": 131,"j": 132, "score": 0.41, "iC": "DENSTA", "jC": "DEKQNGVL", "matrix": [[-0.02, 0.17, 0.01, 0.04, -0.03, -0.22, -0.06, -0.15],[-0.22, -0.09, 0.27, -0.20, 0.31, 0.01, -0.28, -0.08],[0.15, 0.07, -0.01, -0.07, -0.12, -0.19, 0.04, -0.01],[-0.18, 0.10, 0.02, 0.12, -0.12, 0.07, 0.09, 0.11],[-0.09, -0.04, -0.04, 0.14, 0.02, 0.17, 0.11, -0.08],[0.19, 0.03, -0.08, 0.01, -0.09, 0.03, 0.21, 0.18]]},
+ {"i": 132,"j": 129, "score": 1.04, "iC": "DEKRQNSGAVILFW", "jC": "DEKNSPGL", "matrix": [[-0.57, -0.12, 0.11, 0.43, 0.17, -0.18, -0.12, -0.08],[-0.48, -0.25, 0.21, 0.50, 0.16, 0.09, -0.17, -0.03],[0.51, -0.06, -0.05, -0.17, -0.06, -0.02, -0.07, -0.02],[0.26, 0.13, 0.00, -0.11, -0.02, -0.10, -0.12, -0.04],[0.32, -0.04, -0.03, -0.09, -0.05, 0.13, -0.10, -0.01],[-0.05, -0.02, -0.04, 0.24, 0.05, -0.05, -0.05, 0.02],[0.05, -0.07, -0.03, -0.04, 0.01, -0.02, -0.06, 0.16],[-0.28, 0.06, -0.04, -0.07, -0.01, -0.11, -0.08, 0.18],[0.20, 0.10, -0.09, -0.02, -0.04, -0.02, -0.18, -0.04],[0.36, 0.03, -0.05, -0.07, -0.17, -0.06, -0.09, -0.05],[0.40, 0.00, -0.02, -0.02, -0.08, -0.11, -0.06, -0.03],[0.34, -0.01, 0.03, -0.04, 0.03, 0.02, -0.08, -0.04],[-0.35, 0.29, -0.01, -0.12, -0.03, 0.36, -0.10, 0.01],[-0.12, 0.04, -0.02, -0.05, -0.05, -0.07, 0.31, -0.01]]},
+ {"i": 132,"j": 131, "score": 0.41, "iC": "DEKQNGVL", "jC": "DENSTA", "matrix": [[-0.02, -0.22, 0.15, -0.18, -0.09, 0.19],[0.17, -0.09, 0.07, 0.10, -0.04, 0.03],[0.01, 0.27, -0.01, 0.02, -0.04, -0.08],[0.04, -0.20, -0.07, 0.12, 0.14, 0.01],[-0.03, 0.31, -0.12, -0.12, 0.02, -0.09],[-0.22, 0.01, -0.19, 0.07, 0.17, 0.03],[-0.06, -0.28, 0.04, 0.09, 0.11, 0.21],[-0.15, -0.08, -0.01, 0.11, -0.08, 0.18]]},
+ {"i": 132,"j": 133, "score": 1.02, "iC": "DEQNPLFW", "jC": "TVIFW", "matrix": [[-0.02, -0.08, -0.02, 0.07, 0.28],[-0.11, -0.09, -0.07, -0.25, 0.62],[-0.01, -0.08, -0.04, 0.07, 0.24],[-0.00, -0.04, -0.02, 0.02, 0.19],[-0.02, -0.02, -0.01, -0.06, -0.30],[0.00, 0.01, 0.01, 0.04, -0.15],[0.26, 0.44, 0.21, -0.55, -0.66],[0.11, 0.25, 0.14, -0.15, -0.70]]},
+ {"i": 132,"j": 135, "score": 0.47, "iC": "DKRQNAVILF", "jC": "EKRTVIL", "matrix": [[-0.08, -0.23, -0.08, 0.03, 0.12, 0.29, 0.33],[-0.20, 0.20, 0.03, 0.02, -0.04, 0.03, 0.11],[-0.01, -0.00, -0.05, -0.01, -0.17, -0.01, 0.08],[-0.11, -0.03, 0.08, -0.07, -0.10, -0.16, 0.21],[-0.16, -0.01, -0.10, -0.05, 0.06, 0.13, 0.13],[-0.13, -0.06, 0.11, -0.02, 0.21, -0.03, -0.09],[0.07, 0.09, -0.02, -0.05, 0.07, -0.09, -0.37],[0.04, 0.21, 0.06, 0.03, 0.01, -0.02, -0.30],[0.13, -0.07, 0.16, 0.02, 0.08, -0.09, -0.17],[-0.16, 0.10, -0.09, 0.25, 0.06, -0.04, -0.11]]},
+ {"i": 133,"j": 132, "score": 1.02, "iC": "TVIFW", "jC": "DEQNPLFW", "matrix": [[-0.02, -0.11, -0.01, -0.00, -0.02, 0.00, 0.26, 0.11],[-0.08, -0.09, -0.08, -0.04, -0.02, 0.01, 0.44, 0.25],[-0.02, -0.07, -0.04, -0.02, -0.01, 0.01, 0.21, 0.14],[0.07, -0.25, 0.07, 0.02, -0.06, 0.04, -0.55, -0.15],[0.28, 0.62, 0.24, 0.19, -0.30, -0.15, -0.66, -0.70]]},
+ {"i": 133,"j": 134, "score": 0.81, "iC": "DENGFWY", "jC": "EKRHQTGAVLW", "matrix": [[-0.05, -0.08, -0.07, -0.02, -0.06, -0.05, 0.01, -0.03, -0.04, 0.01, 0.28],[0.00, -0.08, -0.03, -0.01, -0.03, -0.03, -0.01, -0.02, -0.02, -0.01, 0.22],[-0.12, -0.09, 0.01, -0.02, -0.04, -0.02, -0.01, 0.02, 0.03, -0.01, 0.21],[0.00, 0.00, -0.06, 0.01, -0.05, 0.00, -0.01, -0.03, -0.02, -0.02, 0.16],[0.18, 0.10, 0.12, -0.12, -0.09, 0.18, -0.02, 0.01, 0.19, -0.25, -0.21],[-0.05, 0.19, 0.35, 0.27, 0.43, 0.11, -0.18, -0.34, -0.06, 0.05, -0.81],[-0.00, -0.01, 0.15, 0.07, 0.11, -0.06, -0.00, 0.06, -0.03, -0.02, -0.08]]},
+ {"i": 133,"j": 135, "score": 0.60, "iC": "HVFWY", "jC": "DETAVLM", "matrix": [[0.10, 0.19, -0.05, 0.02, 0.03, -0.13, 0.01],[0.09, -0.09, 0.25, 0.02, 0.00, -0.11, -0.03],[-0.13, -0.22, -0.28, -0.18, -0.12, 0.45, 0.03],[-0.17, -0.19, -0.18, 0.03, 0.34, 0.44, 0.16],[-0.02, -0.14, -0.06, -0.06, -0.11, 0.19, 0.01]]},
+ {"i": 133,"j": 136, "score": 0.56, "iC": "HFW", "jC": "ESTVLFWY", "matrix": [[-0.03, -0.04, 0.02, -0.10, 0.22, 0.03, -0.03, -0.02],[-0.06, -0.10, 0.16, 0.25, -0.12, -0.15, -0.08, 0.06],[0.22, 0.23, 0.42, 0.15, -0.46, -0.20, -0.21, -0.24]]},
+ {"i": 134,"j": 133, "score": 0.81, "iC": "EKRHQTGAVLW", "jC": "DENGFWY", "matrix": [[-0.05, 0.00, -0.12, 0.00, 0.18, -0.05, -0.00],[-0.08, -0.08, -0.09, 0.00, 0.10, 0.19, -0.01],[-0.07, -0.03, 0.01, -0.06, 0.12, 0.35, 0.15],[-0.02, -0.01, -0.02, 0.01, -0.12, 0.27, 0.07],[-0.06, -0.03, -0.04, -0.05, -0.09, 0.43, 0.11],[-0.05, -0.03, -0.02, 0.00, 0.18, 0.11, -0.06],[0.01, -0.01, -0.01, -0.01, -0.02, -0.18, -0.00],[-0.03, -0.02, 0.02, -0.03, 0.01, -0.34, 0.06],[-0.04, -0.02, 0.03, -0.02, 0.19, -0.06, -0.03],[0.01, -0.01, -0.01, -0.02, -0.25, 0.05, -0.02],[0.28, 0.22, 0.21, 0.16, -0.21, -0.81, -0.08]]},
+ {"i": 134,"j": 135, "score": 0.44, "iC": "DEKHQSTVILMW", "jC": "EQTILMC", "matrix": [[-0.15, -0.07, 0.02, 0.01, 0.07, 0.07, 0.00],[-0.36, -0.12, 0.10, 0.23, 0.15, 0.17, 0.05],[-0.02, -0.04, 0.02, 0.04, 0.10, 0.14, -0.15],[0.09, 0.01, -0.03, -0.01, -0.06, 0.01, 0.17],[0.06, 0.18, -0.03, -0.07, 0.18, -0.17, -0.15],[-0.19, -0.07, -0.04, 0.08, 0.05, -0.01, 0.05],[-0.16, -0.05, -0.16, -0.08, 0.15, 0.02, 0.11],[0.12, 0.04, -0.01, -0.06, -0.15, -0.05, 0.09],[0.25, -0.03, 0.01, -0.09, -0.12, -0.03, -0.00],[0.17, -0.05, 0.16, -0.05, -0.10, -0.03, -0.05],[-0.12, 0.00, -0.02, 0.01, 0.20, 0.01, 0.01],[0.18, 0.05, 0.04, -0.18, -0.32, -0.06, -0.05]]},
+ {"i": 134,"j": 136, "score": 0.50, "iC": "EKRQTAVILW", "jC": "DERTAVILM", "matrix": [[-0.22, -0.11, 0.08, -0.07, 0.07, 0.09, 0.15, 0.01, 0.05],[0.12, 0.02, -0.15, 0.09, -0.06, 0.14, 0.20, -0.16, 0.01],[0.22, 0.18, -0.20, 0.00, 0.04, 0.08, 0.06, -0.08, -0.07],[-0.00, -0.01, -0.11, -0.02, -0.19, 0.18, 0.13, -0.01, -0.01],[-0.05, -0.02, -0.02, 0.28, -0.13, 0.00, -0.03, -0.05, -0.06],[0.00, -0.04, 0.08, 0.04, 0.12, -0.01, -0.16, -0.03, 0.02],[-0.03, 0.00, 0.04, 0.12, 0.05, -0.09, -0.24, -0.04, -0.00],[-0.01, 0.09, 0.06, 0.14, -0.03, -0.26, -0.15, 0.02, -0.01],[-0.05, 0.06, 0.01, 0.04, 0.10, -0.16, -0.05, -0.08, -0.01],[0.00, -0.07, 0.01, -0.30, -0.11, -0.01, 0.15, 0.31, 0.18]]},
+ {"i": 134,"j": 156, "score": 0.67, "iC": "DEKRHQTI", "jC": "DEKRHNT", "matrix": [[-0.11, -0.18, 0.04, 0.08, 0.02, 0.04, 0.12],[-0.21, -0.42, 0.40, 0.42, -0.01, -0.04, -0.15],[0.11, 0.40, -0.05, -0.15, -0.05, -0.17, 0.00],[0.17, 0.53, -0.23, -0.39, -0.07, 0.03, -0.26],[0.04, 0.21, -0.14, -0.05, 0.02, -0.03, 0.01],[-0.03, -0.20, -0.10, 0.03, 0.16, 0.05, 0.05],[-0.07, 0.05, -0.15, -0.03, -0.09, 0.03, 0.11],[-0.02, -0.22, 0.09, 0.03, -0.01, 0.02, 0.08]]},
+ {"i": 135,"j": 132, "score": 0.47, "iC": "EKRTVIL", "jC": "DKRQNAVILF", "matrix": [[-0.08, -0.20, -0.01, -0.11, -0.16, -0.13, 0.07, 0.04, 0.13, -0.16],[-0.23, 0.20, -0.00, -0.03, -0.01, -0.06, 0.09, 0.21, -0.07, 0.10],[-0.08, 0.03, -0.05, 0.08, -0.10, 0.11, -0.02, 0.06, 0.16, -0.09],[0.03, 0.02, -0.01, -0.07, -0.05, -0.02, -0.05, 0.03, 0.02, 0.25],[0.12, -0.04, -0.17, -0.10, 0.06, 0.21, 0.07, 0.01, 0.08, 0.06],[0.29, 0.03, -0.01, -0.16, 0.13, -0.03, -0.09, -0.02, -0.09, -0.04],[0.33, 0.11, 0.08, 0.21, 0.13, -0.09, -0.37, -0.30, -0.17, -0.11]]},
+ {"i": 135,"j": 133, "score": 0.60, "iC": "DETAVLM", "jC": "HVFWY", "matrix": [[0.10, 0.09, -0.13, -0.17, -0.02],[0.19, -0.09, -0.22, -0.19, -0.14],[-0.05, 0.25, -0.28, -0.18, -0.06],[0.02, 0.02, -0.18, 0.03, -0.06],[0.03, 0.00, -0.12, 0.34, -0.11],[-0.13, -0.11, 0.45, 0.44, 0.19],[0.01, -0.03, 0.03, 0.16, 0.01]]},
+ {"i": 135,"j": 134, "score": 0.44, "iC": "EQTILMC", "jC": "DEKHQSTVILMW", "matrix": [[-0.15, -0.36, -0.02, 0.09, 0.06, -0.19, -0.16, 0.12, 0.25, 0.17, -0.12, 0.18],[-0.07, -0.12, -0.04, 0.01, 0.18, -0.07, -0.05, 0.04, -0.03, -0.05, 0.00, 0.05],[0.02, 0.10, 0.02, -0.03, -0.03, -0.04, -0.16, -0.01, 0.01, 0.16, -0.02, 0.04],[0.01, 0.23, 0.04, -0.01, -0.07, 0.08, -0.08, -0.06, -0.09, -0.05, 0.01, -0.18],[0.07, 0.15, 0.10, -0.06, 0.18, 0.05, 0.15, -0.15, -0.12, -0.10, 0.20, -0.32],[0.07, 0.17, 0.14, 0.01, -0.17, -0.01, 0.02, -0.05, -0.03, -0.03, 0.01, -0.06],[0.00, 0.05, -0.15, 0.17, -0.15, 0.05, 0.11, 0.09, -0.00, -0.05, 0.01, -0.05]]},
+ {"i": 135,"j": 138, "score": 1.16, "iC": "EKRL", "jC": "EKRHQSTC", "matrix": [[-0.56, -0.12, 1.32, 0.23, -0.29, 0.06, -0.19, 0.12],[0.47, -0.17, -0.40, -0.08, 0.01, 0.13, -0.03, -0.04],[-0.12, -0.07, -0.18, 0.12, 0.06, -0.16, 0.01, -0.01],[0.35, 0.05, -0.22, -0.14, 0.19, 0.09, 0.03, -0.15]]},
+ {"i": 135,"j": 153, "score": 1.37, "iC": "EKRPAVILMC", "jC": "EKRHQNTAVILMCY", "matrix": [[-0.56, 0.17, 0.11, 0.31, -0.21, -0.16, -0.05, 0.01, 0.52, 0.21, -0.10, -0.15, -0.14, -0.03],[0.22, -0.27, -0.14, -0.06, -0.09, -0.00, 0.10, 0.21, 0.11, 0.01, -0.20, -0.00, 0.08, -0.01],[0.43, -0.12, -0.11, -0.05, -0.08, 0.02, -0.09, 0.05, -0.03, -0.10, -0.15, -0.01, 0.06, -0.01],[-0.08, -0.04, 0.04, -0.04, -0.04, 0.01, 0.16, -0.02, 0.14, 0.03, -0.10, 0.00, 0.00, -0.03],[-0.06, -0.00, -0.03, -0.04, -0.04, -0.03, 0.05, -0.08, 0.30, 0.06, -0.05, 0.03, -0.05, 0.03],[-0.22, 0.06, -0.03, -0.09, -0.06, 0.01, 0.06, -0.18, 0.18, 0.13, 0.23, 0.03, -0.17, 0.04],[-0.18, -0.09, -0.12, 0.00, -0.04, -0.01, -0.12, -0.08, 0.12, 0.23, 0.24, 0.02, -0.08, 0.14],[0.38, 0.23, 0.36, -0.13, 0.55, 0.23, -0.33, -0.04, -1.05, -0.58, 0.33, 0.05, 0.15, -0.17],[0.03, -0.05, 0.09, -0.00, 0.14, 0.00, 0.13, 0.06, -0.18, -0.03, -0.07, -0.03, 0.01, -0.03],[0.08, 0.11, -0.06, 0.00, -0.05, 0.00, 0.05, 0.06, -0.24, -0.14, -0.04, -0.00, 0.16, 0.02]]},
+ {"i": 135,"j": 155, "score": 0.73, "iC": "ERNSTVILC", "jC": "LWY", "matrix": [[0.33, -0.25, -0.16],[-0.16, 0.31, -0.05],[0.15, 0.00, -0.10],[0.18, -0.05, -0.15],[0.43, -0.16, -0.18],[0.17, -0.21, 0.08],[0.16, -0.22, -0.01],[-0.59, 0.28, 0.36],[-0.19, 0.14, 0.07]]},
+ {"i": 136,"j": 133, "score": 0.56, "iC": "ESTVLFWY", "jC": "HFW", "matrix": [[-0.03, -0.06, 0.22],[-0.04, -0.10, 0.23],[0.02, 0.16, 0.42],[-0.10, 0.25, 0.15],[0.22, -0.12, -0.46],[0.03, -0.15, -0.20],[-0.03, -0.08, -0.21],[-0.02, 0.06, -0.24]]},
+ {"i": 136,"j": 134, "score": 0.50, "iC": "DERTAVILM", "jC": "EKRQTAVILW", "matrix": [[-0.22, 0.12, 0.22, -0.00, -0.05, 0.00, -0.03, -0.01, -0.05, 0.00],[-0.11, 0.02, 0.18, -0.01, -0.02, -0.04, 0.00, 0.09, 0.06, -0.07],[0.08, -0.15, -0.20, -0.11, -0.02, 0.08, 0.04, 0.06, 0.01, 0.01],[-0.07, 0.09, 0.00, -0.02, 0.28, 0.04, 0.12, 0.14, 0.04, -0.30],[0.07, -0.06, 0.04, -0.19, -0.13, 0.12, 0.05, -0.03, 0.10, -0.11],[0.09, 0.14, 0.08, 0.18, 0.00, -0.01, -0.09, -0.26, -0.16, -0.01],[0.15, 0.20, 0.06, 0.13, -0.03, -0.16, -0.24, -0.15, -0.05, 0.15],[0.01, -0.16, -0.08, -0.01, -0.05, -0.03, -0.04, 0.02, -0.08, 0.31],[0.05, 0.01, -0.07, -0.01, -0.06, 0.02, -0.00, -0.01, -0.01, 0.18]]},
+ {"i": 136,"j": 137, "score": 0.44, "iC": "ERTVIL", "jC": "EKRSTAVFW", "matrix": [[-0.18, 0.15, 0.04, 0.23, 0.25, -0.20, 0.00, -0.02, 0.02],[0.15, 0.00, -0.01, -0.11, -0.04, -0.05, 0.04, -0.03, -0.02],[-0.04, 0.01, -0.16, -0.44, -0.20, 0.21, -0.00, 0.16, -0.00],[-0.03, -0.06, 0.11, 0.26, -0.18, 0.06, -0.22, 0.13, 0.15],[0.01, 0.11, -0.03, 0.16, -0.08, 0.05, 0.02, -0.09, -0.00],[0.19, 0.00, 0.04, 0.02, 0.02, 0.00, 0.01, -0.08, -0.07]]},
+ {"i": 136,"j": 156, "score": 1.04, "iC": "DEKSTAVIL", "jC": "DEKRHQSTVI", "matrix": [[-0.08, -0.32, -0.05, 0.07, 0.01, -0.05, 0.16, 0.08, 0.05, 0.00],[-0.19, -0.74, 0.08, 0.33, 0.09, -0.22, 0.09, 0.16, 0.30, 0.10],[0.01, 0.20, -0.17, -0.08, 0.05, -0.03, -0.04, 0.00, -0.01, 0.01],[0.21, -0.10, -0.10, -0.14, 0.00, -0.09, 0.05, 0.19, -0.05, -0.05],[0.43, 0.44, -0.12, -0.08, -0.02, 0.02, 0.02, -0.07, -0.23, -0.18],[-0.01, -0.11, 0.00, 0.03, -0.09, -0.22, -0.06, 0.05, 0.13, 0.17],[-0.07, 0.40, 0.07, 0.16, 0.18, 0.06, -0.12, -0.25, -0.23, -0.06],[-0.08, 0.31, 0.13, -0.15, -0.10, 0.36, -0.13, -0.17, -0.16, 0.06],[-0.22, 0.16, 0.05, -0.01, -0.06, 0.23, 0.02, -0.18, -0.15, 0.01]]},
+ {"i": 137,"j": 136, "score": 0.44, "iC": "EKRSTAVFW", "jC": "ERTVIL", "matrix": [[-0.18, 0.15, -0.04, -0.03, 0.01, 0.19],[0.15, 0.00, 0.01, -0.06, 0.11, 0.00],[0.04, -0.01, -0.16, 0.11, -0.03, 0.04],[0.23, -0.11, -0.44, 0.26, 0.16, 0.02],[0.25, -0.04, -0.20, -0.18, -0.08, 0.02],[-0.20, -0.05, 0.21, 0.06, 0.05, 0.00],[0.00, 0.04, -0.00, -0.22, 0.02, 0.01],[-0.02, -0.03, 0.16, 0.13, -0.09, -0.08],[0.02, -0.02, -0.00, 0.15, -0.00, -0.07]]},
+ {"i": 137,"j": 154, "score": 0.67, "iC": "DEKRSGALFW", "jC": "DERHQTVI", "matrix": [[-0.03, -0.09, 0.16, 0.14, -0.05, 0.29, 0.02, -0.10],[-0.25, -0.31, 0.23, 0.04, -0.17, 0.38, -0.00, -0.08],[0.05, 0.20, -0.13, -0.09, 0.02, -0.12, 0.15, 0.01],[-0.00, 0.10, -0.06, -0.02, 0.00, -0.28, 0.02, -0.02],[-0.23, 0.06, -0.00, 0.17, 0.07, -0.44, 0.45, 0.06],[0.00, 0.04, -0.15, 0.02, 0.04, 0.07, -0.03, 0.01],[0.05, -0.08, -0.01, -0.07, 0.02, 0.38, -0.24, -0.05],[0.11, 0.01, -0.03, -0.02, 0.03, -0.15, -0.01, 0.01],[0.12, -0.06, -0.06, -0.03, -0.02, -0.03, -0.08, 0.25],[0.02, 0.00, 0.26, -0.03, 0.06, -0.24, -0.14, -0.04]]},
+ {"i": 138,"j": 135, "score": 1.16, "iC": "EKRHQSTC", "jC": "EKRL", "matrix": [[-0.56, 0.47, -0.12, 0.35],[-0.12, -0.17, -0.07, 0.05],[1.32, -0.40, -0.18, -0.22],[0.23, -0.08, 0.12, -0.14],[-0.29, 0.01, 0.06, 0.19],[0.06, 0.13, -0.16, 0.09],[-0.19, -0.03, 0.01, 0.03],[0.12, -0.04, -0.01, -0.15]]},
+ {"i": 138,"j": 151, "score": 0.94, "iC": "DEKRQSA", "jC": "DEKRSTA", "matrix": [[-0.06, -0.11, 0.02, 0.20, 0.02, -0.12, -0.06],[-0.22, -0.47, 0.19, 0.30, -0.07, 0.09, -0.04],[0.10, 0.01, -0.09, -0.24, -0.05, 0.18, -0.07],[0.38, 0.36, -0.24, -0.92, 0.30, -0.26, 0.31],[-0.05, -0.11, 0.01, -0.07, -0.02, 0.24, -0.02],[-0.04, 0.08, 0.03, 0.23, -0.32, 0.22, -0.07],[-0.06, 0.04, -0.00, 0.11, -0.12, 0.18, -0.08]]},
+ {"i": 138,"j": 153, "score": 0.74, "iC": "DEKRHST", "jC": "EKRQSVILCY", "matrix": [[-0.15, 0.03, 0.14, 0.01, -0.01, -0.05, -0.01, 0.02, -0.04, 0.01],[-0.41, 0.20, 0.15, 0.29, -0.05, -0.07, -0.08, -0.04, 0.01, -0.04],[0.02, -0.15, -0.16, -0.08, -0.03, -0.09, 0.21, 0.15, 0.11, 0.13],[0.06, -0.38, -0.19, -0.28, -0.06, 0.68, 0.27, 0.30, 0.09, -0.15],[-0.09, -0.06, -0.02, -0.03, 0.18, -0.04, 0.01, 0.02, -0.05, -0.01],[0.36, 0.16, -0.02, -0.01, -0.02, -0.08, -0.25, -0.16, -0.23, -0.08],[0.17, 0.07, -0.00, -0.01, -0.03, -0.01, 0.00, -0.06, -0.04, -0.01]]},
+ {"i": 139,"j": 140, "score": 0.61, "iC": "DEKRHQSTPGF", "jC": "EHSTPGAVF", "matrix": [[-0.13, -0.10, -0.13, -0.06, -0.06, -0.05, -0.02, 0.24, 0.35],[-0.13, -0.32, 0.27, 0.15, -0.06, 0.18, -0.11, 0.04, -0.16],[-0.02, -0.04, -0.11, -0.00, 0.03, 0.31, 0.06, -0.05, -0.15],[0.18, 0.23, 0.06, 0.07, -0.07, 0.00, -0.12, -0.07, -0.11],[-0.05, 0.19, -0.08, -0.03, 0.06, -0.11, -0.04, -0.01, 0.10],[-0.01, -0.09, 0.06, -0.03, 0.05, 0.24, 0.05, -0.03, -0.12],[0.11, 0.06, 0.07, -0.03, 0.04, -0.05, -0.07, -0.08, 0.27],[-0.18, -0.07, 0.07, -0.03, 0.17, 0.12, 0.05, 0.00, 0.03],[-0.01, -0.06, -0.18, -0.06, -0.17, 0.29, 0.21, 0.09, -0.07],[0.30, -0.01, -0.05, 0.07, 0.17, -0.36, -0.04, -0.00, -0.03],[0.02, -0.01, 0.02, -0.01, -0.02, -0.19, -0.04, -0.04, -0.04]]},
+ {"i": 139,"j": 141, "score": 0.60, "iC": "DEKRSTPFY", "jC": "DEHQPGVILFW", "matrix": [[0.08, -0.24, 0.01, 0.07, 0.15, -0.08, 0.02, -0.03, 0.03, -0.01, 0.01],[-0.19, -0.31, 0.49, -0.16, -0.04, 0.05, 0.04, -0.02, 0.03, 0.27, 0.01],[-0.02, 0.05, -0.09, -0.17, -0.10, 0.03, -0.03, 0.21, 0.12, 0.01, -0.04],[0.09, 0.48, -0.14, -0.00, -0.20, -0.10, 0.08, -0.01, -0.03, -0.07, -0.09],[0.00, -0.16, -0.03, 0.02, 0.04, -0.04, -0.06, -0.09, -0.01, 0.06, 0.16],[0.01, -0.07, 0.02, -0.07, 0.02, -0.06, -0.13, 0.01, 0.17, -0.05, 0.09],[-0.00, -0.15, -0.06, 0.19, -0.18, 0.36, 0.15, 0.12, -0.09, -0.07, -0.12],[0.21, 0.11, -0.06, 0.11, 0.14, -0.10, -0.09, -0.08, -0.06, -0.07, -0.03],[-0.03, 0.03, -0.04, -0.00, 0.22, 0.02, -0.03, -0.06, -0.06, -0.05, -0.03]]},
+ {"i": 139,"j": 142, "score": 0.40, "iC": "DERHQSPGAF", "jC": "KHQSTPAVIL", "matrix": [[-0.16, -0.08, -0.07, 0.14, 0.05, 0.08, 0.08, 0.02, 0.05, 0.01],[-0.18, 0.05, 0.01, -0.17, 0.05, -0.03, -0.05, 0.20, 0.05, -0.07],[-0.09, 0.17, 0.05, -0.00, -0.19, -0.01, 0.17, -0.07, -0.07, 0.06],[0.11, -0.05, -0.07, 0.11, -0.05, -0.11, 0.28, -0.08, -0.09, -0.05],[-0.05, 0.07, 0.03, 0.01, 0.06, 0.09, -0.15, -0.09, 0.08, 0.04],[-0.07, 0.05, -0.08, -0.01, -0.18, 0.22, -0.13, -0.08, 0.09, 0.06],[-0.03, -0.17, -0.04, -0.07, 0.06, 0.06, -0.13, 0.20, 0.21, 0.03],[0.13, -0.06, 0.34, -0.17, -0.06, -0.12, -0.07, -0.05, -0.04, 0.17],[0.03, -0.06, -0.14, -0.07, -0.03, 0.20, 0.08, 0.10, -0.01, 0.07],[0.25, 0.03, -0.04, -0.06, -0.06, -0.09, 0.10, 0.05, -0.01, -0.05]]},
+ {"i": 139,"j": 151, "score": 0.96, "iC": "DEKRHQNSPGVCF", "jC": "DEKRSTAVCY", "matrix": [[-0.26, -0.21, -0.07, 0.30, 0.64, -0.25, -0.10, -0.16, -0.06, 0.02],[-0.27, -0.27, 0.19, 0.21, -0.10, 0.19, 0.33, -0.01, -0.11, -0.04],[-0.07, 0.22, -0.07, -0.16, -0.03, -0.12, -0.09, -0.01, -0.01, 0.21],[0.00, 0.14, -0.14, -0.30, 0.26, 0.05, 0.04, -0.01, -0.01, 0.02],[0.77, -0.12, -0.03, -0.17, -0.07, 0.10, -0.14, -0.05, -0.05, -0.06],[-0.03, 0.04, -0.03, 0.11, -0.12, -0.13, 0.02, -0.04, 0.02, 0.16],[-0.03, -0.03, 0.03, -0.06, 0.19, -0.11, 0.02, -0.02, 0.04, -0.06],[0.19, -0.15, 0.22, -0.04, -0.15, 0.05, -0.07, -0.04, 0.01, -0.10],[0.04, 0.20, -0.03, -0.03, -0.23, -0.05, 0.00, 0.20, -0.06, -0.09],[-0.10, 0.07, -0.03, 0.26, -0.05, -0.04, 0.00, -0.03, -0.03, -0.02],[0.13, 0.12, 0.00, -0.03, -0.16, -0.11, 0.06, 0.07, -0.05, -0.08],[-0.07, -0.04, 0.04, -0.06, -0.04, -0.06, -0.06, -0.01, 0.33, -0.03],[-0.14, 0.01, 0.01, -0.03, -0.02, 0.20, -0.08, -0.03, 0.09, 0.05]]},
+ {"i": 140,"j": 139, "score": 0.61, "iC": "EHSTPGAVF", "jC": "DEKRHQSTPGF", "matrix": [[-0.13, -0.13, -0.02, 0.18, -0.05, -0.01, 0.11, -0.18, -0.01, 0.30, 0.02],[-0.10, -0.32, -0.04, 0.23, 0.19, -0.09, 0.06, -0.07, -0.06, -0.01, -0.01],[-0.13, 0.27, -0.11, 0.06, -0.08, 0.06, 0.07, 0.07, -0.18, -0.05, 0.02],[-0.06, 0.15, -0.00, 0.07, -0.03, -0.03, -0.03, -0.03, -0.06, 0.07, -0.01],[-0.06, -0.06, 0.03, -0.07, 0.06, 0.05, 0.04, 0.17, -0.17, 0.17, -0.02],[-0.05, 0.18, 0.31, 0.00, -0.11, 0.24, -0.05, 0.12, 0.29, -0.36, -0.19],[-0.02, -0.11, 0.06, -0.12, -0.04, 0.05, -0.07, 0.05, 0.21, -0.04, -0.04],[0.24, 0.04, -0.05, -0.07, -0.01, -0.03, -0.08, 0.00, 0.09, -0.00, -0.04],[0.35, -0.16, -0.15, -0.11, 0.10, -0.12, 0.27, 0.03, -0.07, -0.03, -0.04]]},
+ {"i": 140,"j": 141, "score": 0.58, "iC": "DEHSTGVILFWY", "jC": "DEQSTPGAVIW", "matrix": [[-0.06, -0.10, -0.07, 0.02, 0.09, -0.16, 0.03, -0.01, -0.02, 0.02, 0.14],[-0.07, -0.07, -0.16, 0.04, -0.03, -0.02, 0.17, -0.03, -0.07, -0.04, 0.03],[0.15, 0.02, 0.13, 0.00, -0.13, 0.22, 0.08, 0.14, -0.22, -0.17, -0.07],[0.32, 0.26, -0.03, -0.02, -0.13, -0.10, -0.13, -0.02, -0.10, -0.08, -0.07],[-0.01, -0.04, 0.09, 0.03, -0.02, -0.04, -0.09, 0.06, 0.16, 0.01, -0.10],[-0.29, 0.10, -0.13, -0.17, 0.16, -0.11, -0.24, -0.17, 0.28, 0.46, 0.33],[0.02, -0.07, 0.06, 0.01, 0.02, 0.22, 0.02, 0.03, 0.00, -0.02, -0.07],[-0.01, -0.04, -0.04, -0.05, -0.01, 0.06, -0.02, 0.17, -0.04, -0.01, -0.03],[-0.05, -0.09, 0.00, 0.07, 0.10, 0.20, 0.04, -0.07, 0.02, -0.03, -0.05],[-0.02, 0.06, -0.05, 0.19, 0.03, 0.00, -0.01, 0.03, -0.06, -0.07, -0.03],[-0.02, -0.04, 0.10, 0.05, -0.04, -0.03, -0.03, -0.03, -0.04, 0.04, -0.23],[-0.01, -0.04, 0.04, 0.07, -0.04, 0.17, -0.08, 0.03, -0.04, -0.09, -0.03]]},
+ {"i": 140,"j": 142, "score": 0.71, "iC": "DEKHQNSPGVFWY", "jC": "EKRHQSTPAVMW", "matrix": [[0.02, -0.07, -0.08, -0.04, 0.17, -0.02, -0.08, -0.00, -0.03, -0.01, -0.01, -0.03],[-0.16, -0.09, -0.04, 0.22, 0.05, -0.02, -0.06, -0.08, -0.18, -0.02, -0.03, -0.03],[0.16, -0.09, 0.06, -0.04, -0.01, 0.01, -0.06, -0.03, -0.15, -0.00, -0.00, -0.02],[-0.13, 0.31, -0.10, -0.12, -0.17, 0.16, -0.08, 0.11, 0.51, -0.04, -0.05, -0.03],[-0.00, -0.04, -0.05, 0.15, 0.01, 0.05, -0.04, -0.02, -0.16, 0.06, -0.00, -0.02],[-0.07, -0.00, -0.02, -0.03, -0.01, -0.02, -0.03, 0.12, 0.24, -0.01, 0.01, -0.01],[0.01, -0.23, 0.05, -0.10, -0.08, -0.07, 0.05, 0.29, -0.14, 0.08, 0.02, 0.15],[0.05, 0.03, 0.06, -0.12, 0.18, 0.04, 0.05, -0.05, -0.25, -0.03, -0.03, 0.01],[0.02, -0.04, 0.20, 0.20, 0.02, -0.12, 0.11, -0.24, -0.48, 0.21, 0.20, 0.07],[-0.03, -0.05, -0.11, 0.01, -0.13, 0.00, 0.05, 0.16, 0.03, -0.04, -0.01, -0.02],[-0.11, 0.16, 0.08, -0.10, -0.07, 0.00, -0.12, 0.01, 0.33, 0.02, -0.03, -0.01],[0.06, -0.02, -0.05, -0.06, -0.05, -0.06, 0.19, -0.03, -0.04, 0.13, -0.01, -0.01],[-0.08, 0.12, -0.03, -0.06, 0.03, -0.03, -0.04, 0.01, 0.29, -0.10, 0.00, -0.01]]},
+ {"i": 140,"j": 143, "score": 0.64, "iC": "DEHQSGAILWY", "jC": "DEQSTGVMF", "matrix": [[-0.20, -0.00, -0.04, -0.15, -0.05, -0.07, 0.04, 0.09, 0.05],[-0.34, -0.01, 0.08, -0.16, 0.18, 0.07, 0.36, -0.07, 0.04],[0.57, -0.06, -0.09, -0.06, -0.06, 0.14, -0.14, -0.01, -0.04],[0.01, 0.05, 0.16, -0.02, -0.02, -0.08, 0.03, 0.03, 0.00],[-0.34, -0.22, 0.20, -0.14, -0.13, -0.14, 0.02, 0.15, 0.15],[0.22, -0.03, 0.02, -0.13, 0.16, -0.12, -0.02, 0.02, -0.06],[-0.13, 0.16, -0.06, 0.11, -0.05, 0.00, -0.06, -0.03, 0.03],[0.02, -0.02, -0.06, 0.05, -0.01, 0.15, -0.02, 0.00, -0.02],[-0.15, -0.01, -0.01, 0.02, 0.02, 0.11, -0.03, -0.01, 0.03],[0.02, -0.08, -0.04, 0.38, -0.10, 0.01, -0.05, -0.01, -0.01],[0.24, 0.05, -0.06, 0.12, -0.05, -0.02, 0.01, -0.02, -0.02]]},
+ {"i": 140,"j": 145, "score": 0.39, "iC": "ERHNSTGVFY", "jC": "DEKRSGA", "matrix": [[0.05, 0.07, -0.17, -0.17, 0.09, -0.06, 0.18],[0.09, -0.03, -0.16, 0.07, -0.05, 0.01, 0.05],[-0.05, -0.18, 0.13, 0.30, -0.12, -0.07, -0.12],[0.18, 0.02, -0.04, -0.04, 0.04, -0.02, -0.01],[-0.17, 0.10, -0.24, -0.13, 0.28, 0.07, -0.02],[0.07, 0.09, -0.11, -0.03, 0.01, 0.17, -0.04],[-0.19, 0.08, 0.22, 0.16, -0.18, -0.18, 0.07],[-0.01, -0.07, 0.20, -0.04, -0.06, -0.10, 0.12],[0.03, -0.27, 0.09, -0.01, -0.01, -0.03, -0.10],[-0.18, -0.05, 0.07, 0.06, -0.08, 0.09, -0.06]]},
+ {"i": 140,"j": 146, "score": 0.44, "iC": "DEHGFY", "jC": "EHN", "matrix": [[0.00, -0.03, -0.20],[0.15, -0.12, -0.20],[-0.08, 0.67, 0.14],[-0.07, -0.20, 0.41],[-0.07, 0.05, 0.25],[-0.02, 0.08, 0.26]]},
+ {"i": 140,"j": 147, "score": 0.42, "iC": "DEKHSPGVIFY", "jC": "DEKSPGA", "matrix": [[-0.00, -0.08, 0.07, -0.01, -0.12, 0.16, -0.04],[-0.02, -0.11, 0.02, -0.11, -0.24, 0.38, -0.09],[-0.02, -0.03, 0.00, -0.03, 0.03, 0.19, -0.08],[0.03, 0.09, 0.19, -0.11, 0.16, -0.46, 0.20],[0.22, -0.02, -0.09, -0.00, -0.12, 0.13, -0.04],[-0.05, 0.04, -0.01, 0.04, -0.09, 0.17, -0.04],[-0.04, -0.17, -0.04, 0.02, 0.28, -0.00, -0.24],[-0.02, 0.16, -0.03, -0.00, -0.07, 0.00, -0.02],[0.09, 0.02, 0.05, 0.16, -0.04, -0.07, -0.01],[0.06, 0.12, 0.01, 0.13, 0.10, -0.27, 0.20],[-0.04, 0.09, 0.02, 0.05, 0.01, -0.28, 0.01]]},
+ {"i": 140,"j": 149, "score": 0.40, "iC": "DERHSGVFWY", "jC": "DKRNTPA", "matrix": [[-0.19, 0.02, 0.16, 0.00, 0.02, -0.13, 0.23],[-0.13, 0.40, -0.01, -0.15, 0.01, -0.02, -0.04],[0.21, -0.08, -0.01, 0.02, -0.02, -0.15, -0.11],[0.01, -0.10, -0.11, 0.01, -0.17, 0.15, 0.27],[-0.19, -0.06, 0.10, 0.02, 0.18, 0.03, -0.17],[0.00, -0.02, 0.11, -0.15, -0.13, 0.15, -0.09],[-0.14, 0.02, -0.03, 0.02, 0.08, 0.17, -0.10],[0.22, -0.06, -0.09, 0.20, -0.08, 0.02, 0.11],[-0.01, 0.00, 0.18, 0.03, -0.03, -0.01, -0.07],[0.18, -0.06, -0.02, 0.11, -0.07, -0.05, 0.10]]},
+ {"i": 140,"j": 150, "score": 0.54, "iC": "RHSGAILFY", "jC": "HLMCFY", "matrix": [[-0.05, 0.29, 0.07, 0.05, -0.12, -0.23],[-0.23, -0.27, -0.08, -0.00, 0.56, 0.27],[-0.04, 0.01, -0.01, 0.15, 0.07, 0.01],[0.44, -0.16, -0.10, -0.11, -0.21, 0.14],[0.01, 0.01, -0.04, 0.03, -0.15, 0.08],[0.06, -0.03, -0.01, -0.00, -0.04, -0.15],[0.01, 0.01, 0.04, 0.01, -0.22, -0.04],[-0.17, -0.06, 0.03, -0.06, 0.05, 0.06],[-0.06, 0.11, 0.16, -0.05, -0.06, -0.08]]},
+ {"i": 141,"j": 139, "score": 0.60, "iC": "DEHQPGVILFW", "jC": "DEKRSTPFY", "matrix": [[0.08, -0.19, -0.02, 0.09, 0.00, 0.01, -0.00, 0.21, -0.03],[-0.24, -0.31, 0.05, 0.48, -0.16, -0.07, -0.15, 0.11, 0.03],[0.01, 0.49, -0.09, -0.14, -0.03, 0.02, -0.06, -0.06, -0.04],[0.07, -0.16, -0.17, -0.00, 0.02, -0.07, 0.19, 0.11, -0.00],[0.15, -0.04, -0.10, -0.20, 0.04, 0.02, -0.18, 0.14, 0.22],[-0.08, 0.05, 0.03, -0.10, -0.04, -0.06, 0.36, -0.10, 0.02],[0.02, 0.04, -0.03, 0.08, -0.06, -0.13, 0.15, -0.09, -0.03],[-0.03, -0.02, 0.21, -0.01, -0.09, 0.01, 0.12, -0.08, -0.06],[0.03, 0.03, 0.12, -0.03, -0.01, 0.17, -0.09, -0.06, -0.06],[-0.01, 0.27, 0.01, -0.07, 0.06, -0.05, -0.07, -0.07, -0.05],[0.01, 0.01, -0.04, -0.09, 0.16, 0.09, -0.12, -0.03, -0.03]]},
+ {"i": 141,"j": 140, "score": 0.58, "iC": "DEQSTPGAVIW", "jC": "DEHSTGVILFWY", "matrix": [[-0.06, -0.07, 0.15, 0.32, -0.01, -0.29, 0.02, -0.01, -0.05, -0.02, -0.02, -0.01],[-0.10, -0.07, 0.02, 0.26, -0.04, 0.10, -0.07, -0.04, -0.09, 0.06, -0.04, -0.04],[-0.07, -0.16, 0.13, -0.03, 0.09, -0.13, 0.06, -0.04, 0.00, -0.05, 0.10, 0.04],[0.02, 0.04, 0.00, -0.02, 0.03, -0.17, 0.01, -0.05, 0.07, 0.19, 0.05, 0.07],[0.09, -0.03, -0.13, -0.13, -0.02, 0.16, 0.02, -0.01, 0.10, 0.03, -0.04, -0.04],[-0.16, -0.02, 0.22, -0.10, -0.04, -0.11, 0.22, 0.06, 0.20, 0.00, -0.03, 0.17],[0.03, 0.17, 0.08, -0.13, -0.09, -0.24, 0.02, -0.02, 0.04, -0.01, -0.03, -0.08],[-0.01, -0.03, 0.14, -0.02, 0.06, -0.17, 0.03, 0.17, -0.07, 0.03, -0.03, 0.03],[-0.02, -0.07, -0.22, -0.10, 0.16, 0.28, 0.00, -0.04, 0.02, -0.06, -0.04, -0.04],[0.02, -0.04, -0.17, -0.08, 0.01, 0.46, -0.02, -0.01, -0.03, -0.07, 0.04, -0.09],[0.14, 0.03, -0.07, -0.07, -0.10, 0.33, -0.07, -0.03, -0.05, -0.03, -0.23, -0.03]]},
+ {"i": 141,"j": 142, "score": 0.54, "iC": "DEKQPGAVIW", "jC": "DKRQPGAVIL", "matrix": [[0.03, -0.04, -0.05, -0.14, -0.10, 0.10, 0.07, 0.07, 0.19, 0.00],[-0.03, 0.03, 0.10, -0.13, 0.26, -0.12, 0.01, -0.16, -0.08, -0.02],[-0.08, 0.07, -0.15, -0.09, -0.11, 0.04, 0.24, 0.01, -0.09, 0.03],[0.03, 0.01, 0.06, -0.13, 0.21, -0.06, -0.04, -0.08, -0.03, -0.06],[-0.00, 0.05, -0.10, 0.26, -0.37, -0.00, 0.36, 0.16, -0.05, 0.01],[-0.04, -0.04, -0.13, -0.10, -0.01, 0.11, -0.20, 0.14, 0.19, -0.04],[0.17, -0.18, -0.09, -0.01, 0.08, 0.02, 0.22, 0.07, -0.06, -0.06],[0.03, -0.03, 0.03, 0.13, -0.11, 0.17, -0.08, -0.04, -0.07, 0.04],[0.00, 0.11, 0.20, -0.07, -0.04, -0.07, -0.17, -0.03, -0.03, 0.02],[-0.05, -0.00, 0.10, 0.24, -0.11, -0.12, -0.03, -0.18, -0.04, 0.23]]},
+ {"i": 141,"j": 143, "score": 0.56, "iC": "DEHPGLMW", "jC": "DERHQNSTPGAV", "matrix": [[-0.02, -0.03, 0.01, 0.00, 0.18, -0.04, -0.12, -0.04, -0.03, -0.13, -0.03, 0.07],[-0.20, -0.14, 0.15, 0.45, 0.16, 0.03, -0.06, -0.14, -0.16, -0.07, -0.28, 0.11],[-0.17, -0.09, -0.07, -0.05, -0.07, -0.04, 0.22, -0.07, 0.12, 0.05, 0.38, -0.12],[-0.07, -0.04, -0.06, -0.12, 0.07, 0.09, 0.03, 0.09, 0.01, 0.17, -0.14, -0.05],[-0.22, -0.04, 0.06, -0.00, 0.18, -0.00, 0.02, -0.11, 0.10, -0.11, -0.13, 0.19],[0.04, -0.06, 0.00, -0.05, -0.10, 0.23, 0.09, -0.01, -0.01, 0.01, -0.00, -0.06],[0.15, -0.04, -0.02, -0.02, 0.02, 0.03, 0.01, -0.03, -0.01, 0.03, 0.01, -0.03],[-0.06, 0.26, -0.03, -0.05, -0.02, -0.03, -0.26, 0.36, -0.03, -0.08, -0.08, -0.05]]},
+ {"i": 141,"j": 149, "score": 0.54, "iC": "DEKRHSTPGAVLFW", "jC": "DKRQNSTPGA", "matrix": [[-0.39, 0.11, -0.00, 0.01, -0.08, 0.16, -0.03, 0.10, 0.03, 0.03],[-0.37, 0.14, 0.22, -0.06, -0.10, 0.14, 0.01, 0.12, -0.14, 0.07],[0.32, -0.03, -0.01, -0.02, 0.09, -0.07, -0.05, -0.03, -0.05, -0.20],[0.05, -0.01, -0.04, 0.02, -0.02, -0.03, -0.05, 0.15, 0.02, -0.14],[0.17, -0.01, -0.08, -0.05, -0.07, -0.09, -0.06, -0.12, 0.04, 0.23],[0.22, 0.04, -0.05, -0.02, 0.14, -0.05, -0.03, -0.09, -0.04, 0.12],[-0.01, 0.07, -0.09, 0.10, -0.01, 0.06, 0.08, 0.11, 0.01, -0.16],[-0.04, -0.04, -0.16, -0.16, -0.17, 0.10, 0.11, 0.34, 0.04, 0.19],[-0.04, 0.10, -0.04, 0.09, -0.05, -0.01, -0.02, -0.15, -0.06, 0.09],[-0.00, -0.19, 0.04, 0.00, 0.05, -0.03, -0.10, -0.01, -0.00, 0.20],[-0.11, 0.01, 0.03, 0.03, -0.03, 0.01, 0.20, -0.08, -0.06, -0.10],[0.03, -0.11, 0.03, -0.04, 0.16, -0.07, -0.04, -0.11, 0.14, -0.01],[0.19, -0.02, 0.04, 0.03, 0.03, -0.02, -0.03, -0.16, -0.03, -0.02],[-0.04, -0.08, 0.31, 0.05, -0.01, -0.03, -0.02, -0.04, -0.19, -0.09]]},
+ {"i": 142,"j": 139, "score": 0.40, "iC": "KHQSTPAVIL", "jC": "DERHQSPGAF", "matrix": [[-0.16, -0.18, -0.09, 0.11, -0.05, -0.07, -0.03, 0.13, 0.03, 0.25],[-0.08, 0.05, 0.17, -0.05, 0.07, 0.05, -0.17, -0.06, -0.06, 0.03],[-0.07, 0.01, 0.05, -0.07, 0.03, -0.08, -0.04, 0.34, -0.14, -0.04],[0.14, -0.17, -0.00, 0.11, 0.01, -0.01, -0.07, -0.17, -0.07, -0.06],[0.05, 0.05, -0.19, -0.05, 0.06, -0.18, 0.06, -0.06, -0.03, -0.06],[0.08, -0.03, -0.01, -0.11, 0.09, 0.22, 0.06, -0.12, 0.20, -0.09],[0.08, -0.05, 0.17, 0.28, -0.15, -0.13, -0.13, -0.07, 0.08, 0.10],[0.02, 0.20, -0.07, -0.08, -0.09, -0.08, 0.20, -0.05, 0.10, 0.05],[0.05, 0.05, -0.07, -0.09, 0.08, 0.09, 0.21, -0.04, -0.01, -0.01],[0.01, -0.07, 0.06, -0.05, 0.04, 0.06, 0.03, 0.17, 0.07, -0.05]]},
+ {"i": 142,"j": 140, "score": 0.71, "iC": "EKRHQSTPAVMW", "jC": "DEKHQNSPGVFWY", "matrix": [[0.02, -0.16, 0.16, -0.13, -0.00, -0.07, 0.01, 0.05, 0.02, -0.03, -0.11, 0.06, -0.08],[-0.07, -0.09, -0.09, 0.31, -0.04, -0.00, -0.23, 0.03, -0.04, -0.05, 0.16, -0.02, 0.12],[-0.08, -0.04, 0.06, -0.10, -0.05, -0.02, 0.05, 0.06, 0.20, -0.11, 0.08, -0.05, -0.03],[-0.04, 0.22, -0.04, -0.12, 0.15, -0.03, -0.10, -0.12, 0.20, 0.01, -0.10, -0.06, -0.06],[0.17, 0.05, -0.01, -0.17, 0.01, -0.01, -0.08, 0.18, 0.02, -0.13, -0.07, -0.05, 0.03],[-0.02, -0.02, 0.01, 0.16, 0.05, -0.02, -0.07, 0.04, -0.12, 0.00, 0.00, -0.06, -0.03],[-0.08, -0.06, -0.06, -0.08, -0.04, -0.03, 0.05, 0.05, 0.11, 0.05, -0.12, 0.19, -0.04],[-0.00, -0.08, -0.03, 0.11, -0.02, 0.12, 0.29, -0.05, -0.24, 0.16, 0.01, -0.03, 0.01],[-0.03, -0.18, -0.15, 0.51, -0.16, 0.24, -0.14, -0.25, -0.48, 0.03, 0.33, -0.04, 0.29],[-0.01, -0.02, -0.00, -0.04, 0.06, -0.01, 0.08, -0.03, 0.21, -0.04, 0.02, 0.13, -0.10],[-0.01, -0.03, -0.00, -0.05, -0.00, 0.01, 0.02, -0.03, 0.20, -0.01, -0.03, -0.01, 0.00],[-0.03, -0.03, -0.02, -0.03, -0.02, -0.01, 0.15, 0.01, 0.07, -0.02, -0.01, -0.01, -0.01]]},
+ {"i": 142,"j": 141, "score": 0.54, "iC": "DKRQPGAVIL", "jC": "DEKQPGAVIW", "matrix": [[0.03, -0.03, -0.08, 0.03, -0.00, -0.04, 0.17, 0.03, 0.00, -0.05],[-0.04, 0.03, 0.07, 0.01, 0.05, -0.04, -0.18, -0.03, 0.11, -0.00],[-0.05, 0.10, -0.15, 0.06, -0.10, -0.13, -0.09, 0.03, 0.20, 0.10],[-0.14, -0.13, -0.09, -0.13, 0.26, -0.10, -0.01, 0.13, -0.07, 0.24],[-0.10, 0.26, -0.11, 0.21, -0.37, -0.01, 0.08, -0.11, -0.04, -0.11],[0.10, -0.12, 0.04, -0.06, -0.00, 0.11, 0.02, 0.17, -0.07, -0.12],[0.07, 0.01, 0.24, -0.04, 0.36, -0.20, 0.22, -0.08, -0.17, -0.03],[0.07, -0.16, 0.01, -0.08, 0.16, 0.14, 0.07, -0.04, -0.03, -0.18],[0.19, -0.08, -0.09, -0.03, -0.05, 0.19, -0.06, -0.07, -0.03, -0.04],[0.00, -0.02, 0.03, -0.06, 0.01, -0.04, -0.06, 0.04, 0.02, 0.23]]},
+ {"i": 142,"j": 143, "score": 0.51, "iC": "DEKHQSTPGAVL", "jC": "DEKQNTPGAVF", "matrix": [[-0.16, 0.06, -0.02, -0.02, -0.05, -0.05, 0.01, 0.07, 0.03, 0.01, 0.00],[-0.36, -0.11, 0.01, 0.03, 0.08, -0.02, 0.00, 0.00, 0.09, 0.06, -0.05],[0.11, 0.00, -0.05, -0.09, 0.21, 0.00, -0.03, 0.14, -0.07, -0.12, -0.03],[-0.07, -0.17, 0.00, -0.05, -0.03, 0.15, -0.08, -0.08, -0.10, 0.31, -0.00],[-0.12, 0.07, 0.19, 0.01, 0.05, -0.07, 0.19, -0.05, -0.05, -0.09, -0.01],[-0.04, -0.01, -0.03, -0.03, -0.04, -0.07, 0.09, 0.29, 0.11, -0.07, -0.02],[0.19, -0.10, -0.04, -0.06, -0.05, -0.12, -0.06, -0.07, -0.04, 0.04, 0.17],[-0.11, -0.03, -0.04, -0.06, -0.10, -0.10, 0.01, -0.11, 0.23, 0.11, 0.05],[-0.18, 0.23, 0.02, -0.09, -0.08, 0.02, 0.08, -0.03, 0.11, 0.07, 0.00],[0.33, 0.04, -0.03, -0.05, -0.02, -0.07, -0.08, 0.11, 0.04, -0.05, -0.03],[0.26, -0.06, -0.08, 0.22, 0.07, -0.02, -0.06, -0.10, -0.08, -0.18, -0.04],[-0.04, 0.01, -0.03, -0.01, -0.03, 0.23, -0.04, -0.10, -0.09, 0.07, -0.06]]},
+ {"i": 142,"j": 146, "score": 0.45, "iC": "EKRHNPGAVIW", "jC": "DEHNSGAF", "matrix": [[0.01, -0.08, -0.01, -0.11, -0.01, 0.23, -0.07, 0.23],[0.09, 0.00, 0.08, 0.15, -0.11, 0.06, -0.02, -0.05],[0.17, -0.05, -0.05, -0.06, -0.00, -0.00, -0.04, 0.03],[0.12, -0.06, -0.06, 0.00, 0.09, -0.20, 0.13, 0.01],[-0.03, -0.04, -0.05, -0.08, -0.03, 0.20, 0.00, 0.01],[-0.03, 0.04, -0.13, 0.19, -0.10, 0.02, -0.09, -0.03],[-0.01, 0.19, -0.09, -0.23, 0.00, -0.14, 0.22, -0.01],[-0.07, -0.13, 0.10, 0.48, -0.17, -0.05, 0.02, -0.05],[-0.12, 0.03, 0.13, 0.03, 0.16, -0.09, -0.02, -0.04],[-0.15, -0.03, 0.19, -0.06, 0.00, -0.08, -0.01, -0.03],[-0.02, 0.01, -0.02, -0.08, -0.03, 0.16, -0.02, -0.00]]},
+ {"i": 142,"j": 147, "score": 0.45, "iC": "DKRHQPGAVM", "jC": "DKNPG", "matrix": [[0.15, -0.03, -0.06, -0.04, 0.01],[0.25, -0.30, 0.02, 0.28, -0.21],[0.17, -0.10, -0.02, 0.23, -0.10],[0.02, 0.02, 0.02, -0.04, 0.40],[-0.02, -0.04, 0.17, -0.09, 0.09],[-0.12, 0.12, 0.04, -0.00, -0.26],[-0.11, -0.04, -0.05, 0.15, 0.02],[0.04, -0.04, -0.15, 0.09, -0.28],[-0.09, 0.14, 0.02, -0.21, 0.10],[-0.10, -0.08, -0.02, -0.02, 0.15]]},
+ {"i": 142,"j": 149, "score": 1.04, "iC": "DEKRHTPAVI", "jC": "DEKRNSTPGA", "matrix": [[-0.05, -0.11, 0.02, 0.24, -0.07, 0.06, -0.03, -0.02, -0.06, -0.01],[-0.12, -0.05, 0.12, 0.19, -0.09, -0.21, 0.07, 0.11, -0.02, -0.13],[0.75, 0.14, -0.22, -0.15, 0.27, -0.11, 0.06, -0.49, 0.03, -0.16],[0.67, 0.12, -0.06, -0.09, -0.08, -0.08, -0.12, -0.14, -0.03, -0.07],[0.24, 0.03, -0.00, -0.02, -0.05, -0.09, -0.11, 0.06, -0.08, 0.05],[-0.17, -0.05, 0.05, 0.13, 0.04, 0.09, 0.27, -0.01, -0.08, -0.09],[-0.51, -0.08, -0.04, -0.03, -0.22, 0.14, 0.13, 0.07, 0.25, 0.23],[0.26, -0.23, -0.08, -0.22, 0.26, 0.08, -0.23, 0.19, -0.02, 0.20],[-0.40, -0.06, 0.05, 0.03, -0.06, 0.08, 0.00, 0.31, 0.04, 0.08],[-0.15, -0.00, 0.14, 0.04, -0.05, 0.06, -0.03, 0.02, -0.01, -0.03]]},
+ {"i": 143,"j": 25, "score": 0.56, "iC": "DEKRQNSTG", "jC": "DEKRNSTGA", "matrix": [[0.04, -0.56, 0.16, 0.25, 0.25, -0.12, -0.12, -0.24, 0.52],[-0.06, -0.15, 0.03, 0.05, 0.10, -0.04, -0.08, 0.07, -0.03],[0.05, 0.31, -0.03, -0.02, -0.07, -0.02, 0.01, -0.04, -0.13],[0.11, 0.17, -0.08, -0.05, 0.00, -0.09, -0.05, 0.11, -0.01],[-0.04, -0.31, -0.02, 0.04, 0.05, 0.11, 0.02, 0.05, 0.15],[0.22, 0.03, -0.09, -0.11, -0.02, -0.08, -0.06, -0.06, 0.05],[0.02, 0.24, -0.10, -0.03, -0.05, 0.11, 0.01, -0.02, -0.22],[-0.09, 0.18, -0.00, -0.01, 0.00, 0.06, 0.03, -0.03, -0.12],[-0.07, -0.03, -0.03, 0.00, -0.07, 0.16, 0.16, -0.06, -0.06]]},
+ {"i": 143,"j": 140, "score": 0.64, "iC": "DEQSTGVMF", "jC": "DEHQSGAILWY", "matrix": [[-0.20, -0.34, 0.57, 0.01, -0.34, 0.22, -0.13, 0.02, -0.15, 0.02, 0.24],[-0.00, -0.01, -0.06, 0.05, -0.22, -0.03, 0.16, -0.02, -0.01, -0.08, 0.05],[-0.04, 0.08, -0.09, 0.16, 0.20, 0.02, -0.06, -0.06, -0.01, -0.04, -0.06],[-0.15, -0.16, -0.06, -0.02, -0.14, -0.13, 0.11, 0.05, 0.02, 0.38, 0.12],[-0.05, 0.18, -0.06, -0.02, -0.13, 0.16, -0.05, -0.01, 0.02, -0.10, -0.05],[-0.07, 0.07, 0.14, -0.08, -0.14, -0.12, 0.00, 0.15, 0.11, 0.01, -0.02],[0.04, 0.36, -0.14, 0.03, 0.02, -0.02, -0.06, -0.02, -0.03, -0.05, 0.01],[0.09, -0.07, -0.01, 0.03, 0.15, 0.02, -0.03, 0.00, -0.01, -0.01, -0.02],[0.05, 0.04, -0.04, 0.00, 0.15, -0.06, 0.03, -0.02, 0.03, -0.01, -0.02]]},
+ {"i": 143,"j": 141, "score": 0.56, "iC": "DERHQNSTPGAV", "jC": "DEHPGLMW", "matrix": [[-0.02, -0.20, -0.17, -0.07, -0.22, 0.04, 0.15, -0.06],[-0.03, -0.14, -0.09, -0.04, -0.04, -0.06, -0.04, 0.26],[0.01, 0.15, -0.07, -0.06, 0.06, 0.00, -0.02, -0.03],[0.00, 0.45, -0.05, -0.12, -0.00, -0.05, -0.02, -0.05],[0.18, 0.16, -0.07, 0.07, 0.18, -0.10, 0.02, -0.02],[-0.04, 0.03, -0.04, 0.09, -0.00, 0.23, 0.03, -0.03],[-0.12, -0.06, 0.22, 0.03, 0.02, 0.09, 0.01, -0.26],[-0.04, -0.14, -0.07, 0.09, -0.11, -0.01, -0.03, 0.36],[-0.03, -0.16, 0.12, 0.01, 0.10, -0.01, -0.01, -0.03],[-0.13, -0.07, 0.05, 0.17, -0.11, 0.01, 0.03, -0.08],[-0.03, -0.28, 0.38, -0.14, -0.13, -0.00, 0.01, -0.08],[0.07, 0.11, -0.12, -0.05, 0.19, -0.06, -0.03, -0.05]]},
+ {"i": 143,"j": 142, "score": 0.51, "iC": "DEKQNTPGAVF", "jC": "DEKHQSTPGAVL", "matrix": [[-0.16, -0.36, 0.11, -0.07, -0.12, -0.04, 0.19, -0.11, -0.18, 0.33, 0.26, -0.04],[0.06, -0.11, 0.00, -0.17, 0.07, -0.01, -0.10, -0.03, 0.23, 0.04, -0.06, 0.01],[-0.02, 0.01, -0.05, 0.00, 0.19, -0.03, -0.04, -0.04, 0.02, -0.03, -0.08, -0.03],[-0.02, 0.03, -0.09, -0.05, 0.01, -0.03, -0.06, -0.06, -0.09, -0.05, 0.22, -0.01],[-0.05, 0.08, 0.21, -0.03, 0.05, -0.04, -0.05, -0.10, -0.08, -0.02, 0.07, -0.03],[-0.05, -0.02, 0.00, 0.15, -0.07, -0.07, -0.12, -0.10, 0.02, -0.07, -0.02, 0.23],[0.01, 0.00, -0.03, -0.08, 0.19, 0.09, -0.06, 0.01, 0.08, -0.08, -0.06, -0.04],[0.07, 0.00, 0.14, -0.08, -0.05, 0.29, -0.07, -0.11, -0.03, 0.11, -0.10, -0.10],[0.03, 0.09, -0.07, -0.10, -0.05, 0.11, -0.04, 0.23, 0.11, 0.04, -0.08, -0.09],[0.01, 0.06, -0.12, 0.31, -0.09, -0.07, 0.04, 0.11, 0.07, -0.05, -0.18, 0.07],[0.00, -0.05, -0.03, -0.00, -0.01, -0.02, 0.17, 0.05, 0.00, -0.03, -0.04, -0.06]]},
+ {"i": 143,"j": 144, "score": 0.46, "iC": "DERHQSTGV", "jC": "DERSTPGAL", "matrix": [[0.10, 0.19, -0.02, -0.01, -0.20, 0.03, -0.14, 0.24, -0.10],[-0.13, -0.30, 0.15, -0.04, 0.07, -0.03, 0.29, -0.03, 0.02],[0.21, -0.04, -0.03, 0.03, -0.06, -0.06, -0.05, -0.02, -0.01],[-0.02, -0.01, 0.02, -0.05, -0.02, 0.05, -0.04, -0.06, 0.16],[-0.19, 0.06, 0.04, 0.01, 0.08, -0.11, -0.05, -0.03, 0.01],[0.09, 0.21, 0.05, -0.27, -0.08, -0.05, 0.01, 0.05, -0.00],[-0.04, -0.20, -0.05, 0.18, -0.01, -0.08, 0.15, 0.10, 0.04],[-0.06, 0.18, -0.05, -0.07, -0.01, 0.34, -0.09, -0.16, -0.05],[-0.08, -0.12, -0.07, 0.16, 0.18, 0.05, 0.03, -0.04, 0.01]]},
+ {"i": 143,"j": 145, "score": 0.84, "iC": "DEQSTPGAVIM", "jC": "DEKRQPGAY", "matrix": [[-0.27, -0.60, 0.66, 0.54, 0.19, -0.23, -0.37, 0.10, -0.13],[-0.02, -0.06, -0.09, -0.01, -0.08, 0.16, -0.05, -0.02, 0.04],[-0.07, 0.11, -0.09, -0.04, -0.01, 0.02, 0.01, -0.00, 0.18],[0.03, -0.19, 0.21, -0.12, -0.02, -0.04, -0.00, -0.05, 0.00],[-0.06, -0.10, -0.04, 0.03, -0.07, -0.01, 0.11, 0.22, -0.08],[0.05, 0.17, -0.11, -0.08, 0.01, 0.04, 0.06, 0.00, -0.02],[0.11, -0.17, 0.14, 0.05, -0.01, -0.10, -0.02, -0.14, 0.07],[0.08, 0.00, -0.20, -0.20, -0.03, 0.12, 0.30, -0.02, -0.04],[0.17, -0.10, -0.16, 0.02, 0.02, 0.02, 0.10, 0.21, -0.06],[0.05, 0.23, -0.08, -0.03, -0.04, 0.02, -0.02, 0.01, -0.05],[0.01, 0.18, 0.01, -0.00, -0.02, -0.02, -0.03, -0.04, -0.06]]},
+ {"i": 143,"j": 146, "score": 0.80, "iC": "DERQNTGAV", "jC": "DEKHNSG", "matrix": [[-0.43, -0.30, -0.17, 0.70, 0.60, 0.20, -0.22],[0.04, 0.02, -0.03, -0.08, -0.21, -0.01, -0.05],[0.04, 0.04, -0.09, -0.06, -0.03, -0.04, 0.16],[-0.08, -0.06, 0.19, -0.06, -0.01, -0.22, -0.08],[0.06, -0.05, -0.06, -0.01, 0.22, -0.02, -0.06],[0.00, 0.03, -0.03, -0.07, -0.00, 0.16, -0.14],[0.28, -0.02, 0.09, -0.13, -0.14, -0.14, -0.12],[0.03, 0.13, -0.03, -0.07, -0.19, 0.04, 0.10],[-0.02, -0.02, 0.24, -0.09, -0.13, 0.03, -0.07]]},
+ {"i": 143,"j": 147, "score": 0.37, "iC": "DRHQNTGAV", "jC": "DKNSTPGA", "matrix": [[-0.15, 0.16, -0.16, -0.03, -0.16, 0.04, -0.37, 0.35],[-0.06, -0.01, -0.06, -0.04, 0.05, -0.01, 0.19, -0.02],[0.16, -0.02, 0.08, -0.06, 0.03, -0.01, 0.05, -0.04],[0.05, -0.05, 0.01, -0.03, 0.01, -0.06, 0.23, -0.11],[0.02, -0.01, -0.09, 0.00, 0.05, 0.24, -0.19, -0.06],[-0.00, 0.01, -0.06, 0.05, -0.03, 0.04, 0.21, -0.05],[0.19, -0.06, 0.14, 0.19, -0.01, 0.05, -0.21, -0.15],[0.01, 0.06, 0.01, 0.03, 0.13, -0.11, -0.27, 0.07],[-0.03, -0.00, -0.04, -0.01, 0.00, 0.02, 0.17, 0.11]]},
+ {"i": 144,"j": 143, "score": 0.46, "iC": "DERSTPGAL", "jC": "DERHQSTGV", "matrix": [[0.10, -0.13, 0.21, -0.02, -0.19, 0.09, -0.04, -0.06, -0.08],[0.19, -0.30, -0.04, -0.01, 0.06, 0.21, -0.20, 0.18, -0.12],[-0.02, 0.15, -0.03, 0.02, 0.04, 0.05, -0.05, -0.05, -0.07],[-0.01, -0.04, 0.03, -0.05, 0.01, -0.27, 0.18, -0.07, 0.16],[-0.20, 0.07, -0.06, -0.02, 0.08, -0.08, -0.01, -0.01, 0.18],[0.03, -0.03, -0.06, 0.05, -0.11, -0.05, -0.08, 0.34, 0.05],[-0.14, 0.29, -0.05, -0.04, -0.05, 0.01, 0.15, -0.09, 0.03],[0.24, -0.03, -0.02, -0.06, -0.03, 0.05, 0.10, -0.16, -0.04],[-0.10, 0.02, -0.01, 0.16, 0.01, -0.00, 0.04, -0.05, 0.01]]},
+ {"i": 144,"j": 145, "score": 0.91, "iC": "DEKQSTPGAVI", "jC": "DEKRHQSTPGA", "matrix": [[-0.15, -0.32, 0.39, 0.34, -0.05, 0.04, 0.03, -0.13, -0.13, 0.20, -0.07],[-0.54, -0.30, 0.72, 0.44, 0.16, -0.10, -0.22, -0.10, -0.14, 0.05, -0.11],[0.05, 0.16, -0.12, -0.07, 0.05, -0.02, 0.04, 0.07, -0.06, 0.03, -0.10],[-0.00, 0.06, -0.16, -0.10, 0.03, 0.02, 0.07, -0.05, -0.00, 0.08, 0.05],[0.03, -0.06, -0.16, 0.19, -0.04, -0.01, 0.07, 0.17, -0.13, 0.06, 0.02],[0.08, 0.05, -0.10, -0.14, -0.04, -0.12, 0.07, -0.09, 0.15, -0.09, 0.17],[0.22, 0.05, -0.19, -0.05, -0.06, 0.10, -0.04, 0.06, 0.06, -0.14, -0.01],[-0.10, -0.03, 0.04, -0.11, -0.02, -0.01, -0.02, 0.01, 0.20, -0.01, 0.05],[0.12, 0.11, -0.00, -0.24, -0.07, 0.18, -0.11, -0.03, 0.09, -0.11, 0.09],[0.16, 0.09, -0.09, -0.09, 0.03, -0.04, 0.06, -0.01, -0.01, -0.01, -0.03],[0.10, 0.18, -0.09, -0.04, -0.00, -0.01, 0.03, -0.03, -0.02, -0.05, -0.01]]},
+ {"i": 144,"j": 146, "score": 0.40, "iC": "DERQSTGA", "jC": "DEKHNTGF", "matrix": [[-0.04, -0.06, -0.04, 0.18, 0.03, -0.00, -0.09, -0.05],[-0.03, -0.16, 0.10, 0.05, 0.31, -0.14, -0.06, -0.11],[0.17, 0.09, -0.05, -0.07, -0.20, -0.02, 0.16, -0.03],[-0.00, -0.01, -0.02, 0.01, -0.09, 0.02, 0.15, -0.02],[-0.17, 0.05, 0.21, -0.11, -0.12, 0.32, -0.24, -0.07],[0.21, -0.05, -0.04, -0.10, -0.05, -0.00, -0.08, 0.17],[0.01, 0.10, -0.09, -0.07, 0.02, -0.08, 0.16, -0.03],[-0.04, 0.02, -0.11, 0.12, 0.26, -0.20, -0.05, 0.00]]},
+ {"i": 144,"j": 147, "score": 0.40, "iC": "DEKRQSP", "jC": "DERNPGL", "matrix": [[-0.28, 0.06, -0.00, -0.01, 0.04, -0.01, -0.04],[-0.24, -0.19, 0.20, -0.20, -0.17, 0.35, 0.01],[0.04, -0.00, 0.00, -0.03, 0.07, -0.27, 0.08],[0.17, 0.01, -0.01, 0.11, 0.01, -0.16, -0.00],[0.01, 0.07, -0.07, -0.10, -0.09, 0.01, 0.17],[-0.03, -0.10, -0.07, 0.08, -0.07, 0.43, -0.06],[-0.01, 0.21, -0.11, 0.15, -0.02, -0.07, -0.04]]},
+ {"i": 145,"j": 24, "score": 0.58, "iC": "DEKRHGY", "jC": "KRSP", "matrix": [[0.42, 0.06, -0.05, -0.37],[0.26, 0.12, 0.09, -0.34],[-0.48, -0.06, 0.32, 0.11],[-0.15, -0.21, 0.16, 0.20],[-0.02, 0.17, -0.17, 0.08],[0.21, 0.01, -0.06, -0.17],[-0.04, -0.04, -0.19, 0.25]]},
+ {"i": 145,"j": 25, "score": 0.37, "iC": "DEKRSTA", "jC": "DEKTA", "matrix": [[-0.11, -0.17, 0.08, 0.15, 0.03],[-0.35, -0.31, 0.06, 0.23, -0.02],[-0.11, -0.20, -0.02, 0.03, 0.19],[0.46, -0.04, -0.15, -0.07, -0.12],[-0.06, 0.24, -0.02, -0.04, 0.04],[-0.05, 0.18, 0.12, -0.05, -0.05],[0.02, 0.30, -0.08, -0.05, 0.03]]},
+ {"i": 145,"j": 140, "score": 0.39, "iC": "DEKRSGA", "jC": "ERHNSTGVFY", "matrix": [[0.05, 0.09, -0.05, 0.18, -0.17, 0.07, -0.19, -0.01, 0.03, -0.18],[0.07, -0.03, -0.18, 0.02, 0.10, 0.09, 0.08, -0.07, -0.27, -0.05],[-0.17, -0.16, 0.13, -0.04, -0.24, -0.11, 0.22, 0.20, 0.09, 0.07],[-0.17, 0.07, 0.30, -0.04, -0.13, -0.03, 0.16, -0.04, -0.01, 0.06],[0.09, -0.05, -0.12, 0.04, 0.28, 0.01, -0.18, -0.06, -0.01, -0.08],[-0.06, 0.01, -0.07, -0.02, 0.07, 0.17, -0.18, -0.10, -0.03, 0.09],[0.18, 0.05, -0.12, -0.01, -0.02, -0.04, 0.07, 0.12, -0.10, -0.06]]},
+ {"i": 145,"j": 143, "score": 0.84, "iC": "DEKRQPGAY", "jC": "DEQSTPGAVIM", "matrix": [[-0.27, -0.02, -0.07, 0.03, -0.06, 0.05, 0.11, 0.08, 0.17, 0.05, 0.01],[-0.60, -0.06, 0.11, -0.19, -0.10, 0.17, -0.17, 0.00, -0.10, 0.23, 0.18],[0.66, -0.09, -0.09, 0.21, -0.04, -0.11, 0.14, -0.20, -0.16, -0.08, 0.01],[0.54, -0.01, -0.04, -0.12, 0.03, -0.08, 0.05, -0.20, 0.02, -0.03, -0.00],[0.19, -0.08, -0.01, -0.02, -0.07, 0.01, -0.01, -0.03, 0.02, -0.04, -0.02],[-0.23, 0.16, 0.02, -0.04, -0.01, 0.04, -0.10, 0.12, 0.02, 0.02, -0.02],[-0.37, -0.05, 0.01, -0.00, 0.11, 0.06, -0.02, 0.30, 0.10, -0.02, -0.03],[0.10, -0.02, -0.00, -0.05, 0.22, 0.00, -0.14, -0.02, 0.21, 0.01, -0.04],[-0.13, 0.04, 0.18, 0.00, -0.08, -0.02, 0.07, -0.04, -0.06, -0.05, -0.06]]},
+ {"i": 145,"j": 144, "score": 0.91, "iC": "DEKRHQSTPGA", "jC": "DEKQSTPGAVI", "matrix": [[-0.15, -0.54, 0.05, -0.00, 0.03, 0.08, 0.22, -0.10, 0.12, 0.16, 0.10],[-0.32, -0.30, 0.16, 0.06, -0.06, 0.05, 0.05, -0.03, 0.11, 0.09, 0.18],[0.39, 0.72, -0.12, -0.16, -0.16, -0.10, -0.19, 0.04, -0.00, -0.09, -0.09],[0.34, 0.44, -0.07, -0.10, 0.19, -0.14, -0.05, -0.11, -0.24, -0.09, -0.04],[-0.05, 0.16, 0.05, 0.03, -0.04, -0.04, -0.06, -0.02, -0.07, 0.03, -0.00],[0.04, -0.10, -0.02, 0.02, -0.01, -0.12, 0.10, -0.01, 0.18, -0.04, -0.01],[0.03, -0.22, 0.04, 0.07, 0.07, 0.07, -0.04, -0.02, -0.11, 0.06, 0.03],[-0.13, -0.10, 0.07, -0.05, 0.17, -0.09, 0.06, 0.01, -0.03, -0.01, -0.03],[-0.13, -0.14, -0.06, -0.00, -0.13, 0.15, 0.06, 0.20, 0.09, -0.01, -0.02],[0.20, 0.05, 0.03, 0.08, 0.06, -0.09, -0.14, -0.01, -0.11, -0.01, -0.05],[-0.07, -0.11, -0.10, 0.05, 0.02, 0.17, -0.01, 0.05, 0.09, -0.03, -0.01]]},
+ {"i": 145,"j": 146, "score": 0.78, "iC": "DEKRNSTPGA", "jC": "DEKRHNSTPGA", "matrix": [[-0.16, -0.02, 0.04, 0.03, -0.17, -0.28, -0.05, -0.00, 0.20, 0.24, 0.17],[-0.22, -0.39, 0.18, 0.16, -0.10, 0.42, -0.07, -0.06, -0.02, 0.18, 0.01],[0.10, -0.08, -0.09, -0.04, 0.11, 0.23, 0.12, 0.10, -0.08, -0.27, -0.12],[0.09, -0.10, -0.05, -0.05, 0.31, -0.05, -0.15, 0.37, -0.03, -0.20, -0.06],[-0.09, -0.05, 0.02, -0.03, 0.04, -0.09, -0.08, 0.01, 0.03, 0.28, 0.02],[-0.14, 0.01, -0.02, 0.08, -0.03, -0.21, 0.09, 0.14, -0.00, 0.22, -0.02],[-0.06, 0.01, 0.02, 0.01, 0.05, -0.17, 0.07, -0.02, 0.02, 0.03, 0.01],[0.12, 0.17, 0.01, -0.03, -0.08, 0.07, -0.10, -0.11, -0.03, -0.04, -0.05],[0.20, 0.29, -0.08, -0.03, -0.04, -0.13, -0.01, 0.04, -0.04, -0.30, 0.07],[0.14, 0.08, 0.01, -0.00, -0.13, -0.15, 0.22, -0.20, -0.03, 0.04, 0.07]]},
+ {"i": 145,"j": 147, "score": 0.47, "iC": "DEKRQSGAY", "jC": "DERHQNSTPGA", "matrix": [[-0.18, -0.04, 0.30, -0.07, 0.10, 0.15, 0.01, -0.10, 0.20, -0.05, -0.04],[-0.10, -0.07, -0.04, 0.35, -0.01, 0.02, -0.15, -0.13, -0.03, 0.34, -0.06],[-0.14, 0.07, 0.11, -0.11, 0.08, -0.06, -0.04, -0.09, -0.07, -0.18, 0.04],[-0.07, 0.16, -0.01, -0.06, -0.15, -0.00, 0.13, -0.02, -0.16, -0.16, 0.16],[-0.08, -0.04, -0.04, 0.01, 0.05, -0.03, 0.15, -0.01, 0.11, -0.07, -0.02],[-0.03, 0.07, -0.05, -0.04, -0.03, -0.00, -0.06, 0.05, -0.05, 0.15, 0.01],[0.07, -0.06, -0.01, -0.02, -0.07, -0.04, -0.09, 0.26, -0.03, -0.32, 0.01],[0.02, -0.06, -0.03, 0.04, -0.03, -0.01, 0.07, -0.02, -0.07, 0.33, 0.05],[0.28, 0.02, -0.03, -0.01, -0.04, 0.01, 0.01, -0.03, -0.05, -0.06, -0.00]]},
+ {"i": 146,"j": 23, "score": 0.36, "iC": "HNG", "jC": "VILM", "matrix": [[-0.06, -0.27, 0.32, 0.03],[-0.25, -0.20, 0.42, 0.30],[0.10, 0.15, -0.06, -0.04]]},
+ {"i": 146,"j": 25, "score": 0.65, "iC": "DHNTP", "jC": "DERNSTA", "matrix": [[-0.21, -0.13, -0.02, -0.12, 0.45, 0.27, -0.20],[0.47, -0.27, -0.03, 0.44, -0.08, -0.10, -0.41],[-0.32, -0.37, 0.21, -0.09, -0.02, 0.17, 0.43],[0.02, 0.13, -0.01, -0.07, -0.05, -0.05, 0.18],[0.09, 0.15, -0.01, -0.02, -0.02, -0.02, -0.06]]},
+ {"i": 146,"j": 140, "score": 0.44, "iC": "EHN", "jC": "DEHGFY", "matrix": [[0.00, 0.15, -0.08, -0.07, -0.07, -0.02],[-0.03, -0.12, 0.67, -0.20, 0.05, 0.08],[-0.20, -0.20, 0.14, 0.41, 0.25, 0.26]]},
+ {"i": 146,"j": 142, "score": 0.45, "iC": "DEHNSGAF", "jC": "EKRHNPGAVIW", "matrix": [[0.01, 0.09, 0.17, 0.12, -0.03, -0.03, -0.01, -0.07, -0.12, -0.15, -0.02],[-0.08, 0.00, -0.05, -0.06, -0.04, 0.04, 0.19, -0.13, 0.03, -0.03, 0.01],[-0.01, 0.08, -0.05, -0.06, -0.05, -0.13, -0.09, 0.10, 0.13, 0.19, -0.02],[-0.11, 0.15, -0.06, 0.00, -0.08, 0.19, -0.23, 0.48, 0.03, -0.06, -0.08],[-0.01, -0.11, -0.00, 0.09, -0.03, -0.10, 0.00, -0.17, 0.16, 0.00, -0.03],[0.23, 0.06, -0.00, -0.20, 0.20, 0.02, -0.14, -0.05, -0.09, -0.08, 0.16],[-0.07, -0.02, -0.04, 0.13, 0.00, -0.09, 0.22, 0.02, -0.02, -0.01, -0.02],[0.23, -0.05, 0.03, 0.01, 0.01, -0.03, -0.01, -0.05, -0.04, -0.03, -0.00]]},
+ {"i": 146,"j": 143, "score": 0.80, "iC": "DEKHNSG", "jC": "DERQNTGAV", "matrix": [[-0.43, 0.04, 0.04, -0.08, 0.06, 0.00, 0.28, 0.03, -0.02],[-0.30, 0.02, 0.04, -0.06, -0.05, 0.03, -0.02, 0.13, -0.02],[-0.17, -0.03, -0.09, 0.19, -0.06, -0.03, 0.09, -0.03, 0.24],[0.70, -0.08, -0.06, -0.06, -0.01, -0.07, -0.13, -0.07, -0.09],[0.60, -0.21, -0.03, -0.01, 0.22, -0.00, -0.14, -0.19, -0.13],[0.20, -0.01, -0.04, -0.22, -0.02, 0.16, -0.14, 0.04, 0.03],[-0.22, -0.05, 0.16, -0.08, -0.06, -0.14, -0.12, 0.10, -0.07]]},
+ {"i": 146,"j": 144, "score": 0.40, "iC": "DEKHNTGF", "jC": "DERQSTGA", "matrix": [[-0.04, -0.03, 0.17, -0.00, -0.17, 0.21, 0.01, -0.04],[-0.06, -0.16, 0.09, -0.01, 0.05, -0.05, 0.10, 0.02],[-0.04, 0.10, -0.05, -0.02, 0.21, -0.04, -0.09, -0.11],[0.18, 0.05, -0.07, 0.01, -0.11, -0.10, -0.07, 0.12],[0.03, 0.31, -0.20, -0.09, -0.12, -0.05, 0.02, 0.26],[-0.00, -0.14, -0.02, 0.02, 0.32, -0.00, -0.08, -0.20],[-0.09, -0.06, 0.16, 0.15, -0.24, -0.08, 0.16, -0.05],[-0.05, -0.11, -0.03, -0.02, -0.07, 0.17, -0.03, 0.00]]},
+ {"i": 146,"j": 145, "score": 0.78, "iC": "DEKRHNSTPGA", "jC": "DEKRNSTPGA", "matrix": [[-0.16, -0.22, 0.10, 0.09, -0.09, -0.14, -0.06, 0.12, 0.20, 0.14],[-0.02, -0.39, -0.08, -0.10, -0.05, 0.01, 0.01, 0.17, 0.29, 0.08],[0.04, 0.18, -0.09, -0.05, 0.02, -0.02, 0.02, 0.01, -0.08, 0.01],[0.03, 0.16, -0.04, -0.05, -0.03, 0.08, 0.01, -0.03, -0.03, -0.00],[-0.17, -0.10, 0.11, 0.31, 0.04, -0.03, 0.05, -0.08, -0.04, -0.13],[-0.28, 0.42, 0.23, -0.05, -0.09, -0.21, -0.17, 0.07, -0.13, -0.15],[-0.05, -0.07, 0.12, -0.15, -0.08, 0.09, 0.07, -0.10, -0.01, 0.22],[-0.00, -0.06, 0.10, 0.37, 0.01, 0.14, -0.02, -0.11, 0.04, -0.20],[0.20, -0.02, -0.08, -0.03, 0.03, -0.00, 0.02, -0.03, -0.04, -0.03],[0.24, 0.18, -0.27, -0.20, 0.28, 0.22, 0.03, -0.04, -0.30, 0.04],[0.17, 0.01, -0.12, -0.06, 0.02, -0.02, 0.01, -0.05, 0.07, 0.07]]},
+ {"i": 146,"j": 147, "score": 0.83, "iC": "DEKRHQNSTGAF", "jC": "DEQTPGAL", "matrix": [[-0.07, 0.10, -0.04, 0.15, -0.33, 0.06, -0.09, -0.04],[-0.26, -0.05, -0.05, 0.10, 0.04, 0.04, 0.02, -0.01],[-0.02, -0.04, 0.03, 0.07, -0.12, 0.18, -0.06, -0.01],[-0.08, -0.01, -0.03, -0.02, 0.15, -0.04, -0.00, -0.01],[-0.07, -0.14, -0.06, -0.04, -0.15, -0.21, 0.57, 0.26],[-0.02, -0.06, 0.06, -0.03, 0.22, -0.13, 0.00, -0.02],[-0.05, 0.08, 0.01, -0.13, 0.32, 0.19, -0.28, -0.03],[-0.03, -0.06, -0.10, -0.08, -0.11, 0.37, -0.08, -0.02],[-0.09, -0.01, -0.02, 0.08, -0.03, 0.23, -0.01, -0.02],[0.53, 0.26, 0.20, -0.02, -0.29, -0.46, -0.11, -0.01],[-0.01, -0.04, 0.04, -0.04, -0.01, 0.15, 0.00, -0.03],[0.16, 0.00, -0.02, -0.02, 0.11, -0.20, -0.03, -0.01]]},
+ {"i": 146,"j": 148, "score": 0.66, "iC": "DEKHNSTGAV", "jC": "EHTPAVILFY", "matrix": [[0.03, 0.07, 0.16, -0.13, 0.29, 0.09, -0.12, -0.06, -0.11, -0.04],[0.06, -0.07, -0.04, 0.16, 0.06, -0.04, 0.01, -0.02, -0.04, -0.05],[0.01, -0.00, -0.04, 0.03, 0.05, 0.04, 0.22, -0.15, -0.10, -0.16],[-0.03, 0.11, -0.02, -0.10, -0.03, 0.04, -0.18, -0.31, 0.12, 0.23],[-0.16, 0.23, 0.16, -0.33, -0.15, -0.22, 0.15, -0.03, 0.28, 0.42],[-0.01, -0.08, -0.09, 0.00, -0.12, 0.08, 0.16, 0.27, -0.18, 0.03],[-0.01, -0.03, 0.02, 0.11, -0.09, 0.06, 0.04, 0.19, -0.12, -0.11],[-0.03, -0.17, -0.04, 0.37, 0.06, 0.13, -0.10, -0.06, -0.15, 0.03],[-0.02, -0.02, -0.02, 0.03, -0.04, 0.04, 0.05, 0.04, -0.01, -0.17],[0.04, -0.03, -0.02, -0.01, -0.00, -0.04, -0.05, -0.02, 0.15, -0.02]]},
+ {"i": 147,"j": 140, "score": 0.42, "iC": "DEKSPGA", "jC": "DEKHSPGVIFY", "matrix": [[-0.00, -0.02, -0.02, 0.03, 0.22, -0.05, -0.04, -0.02, 0.09, 0.06, -0.04],[-0.08, -0.11, -0.03, 0.09, -0.02, 0.04, -0.17, 0.16, 0.02, 0.12, 0.09],[0.07, 0.02, 0.00, 0.19, -0.09, -0.01, -0.04, -0.03, 0.05, 0.01, 0.02],[-0.01, -0.11, -0.03, -0.11, -0.00, 0.04, 0.02, -0.00, 0.16, 0.13, 0.05],[-0.12, -0.24, 0.03, 0.16, -0.12, -0.09, 0.28, -0.07, -0.04, 0.10, 0.01],[0.16, 0.38, 0.19, -0.46, 0.13, 0.17, -0.00, 0.00, -0.07, -0.27, -0.28],[-0.04, -0.09, -0.08, 0.20, -0.04, -0.04, -0.24, -0.02, -0.01, 0.20, 0.01]]},
+ {"i": 147,"j": 142, "score": 0.45, "iC": "DKNPG", "jC": "DKRHQPGAVM", "matrix": [[0.15, 0.25, 0.17, 0.02, -0.02, -0.12, -0.11, 0.04, -0.09, -0.10],[-0.03, -0.30, -0.10, 0.02, -0.04, 0.12, -0.04, -0.04, 0.14, -0.08],[-0.06, 0.02, -0.02, 0.02, 0.17, 0.04, -0.05, -0.15, 0.02, -0.02],[-0.04, 0.28, 0.23, -0.04, -0.09, -0.00, 0.15, 0.09, -0.21, -0.02],[0.01, -0.21, -0.10, 0.40, 0.09, -0.26, 0.02, -0.28, 0.10, 0.15]]},
+ {"i": 147,"j": 143, "score": 0.37, "iC": "DKNSTPGA", "jC": "DRHQNTGAV", "matrix": [[-0.15, -0.06, 0.16, 0.05, 0.02, -0.00, 0.19, 0.01, -0.03],[0.16, -0.01, -0.02, -0.05, -0.01, 0.01, -0.06, 0.06, -0.00],[-0.16, -0.06, 0.08, 0.01, -0.09, -0.06, 0.14, 0.01, -0.04],[-0.03, -0.04, -0.06, -0.03, 0.00, 0.05, 0.19, 0.03, -0.01],[-0.16, 0.05, 0.03, 0.01, 0.05, -0.03, -0.01, 0.13, 0.00],[0.04, -0.01, -0.01, -0.06, 0.24, 0.04, 0.05, -0.11, 0.02],[-0.37, 0.19, 0.05, 0.23, -0.19, 0.21, -0.21, -0.27, 0.17],[0.35, -0.02, -0.04, -0.11, -0.06, -0.05, -0.15, 0.07, 0.11]]},
+ {"i": 147,"j": 144, "score": 0.40, "iC": "DERNPGL", "jC": "DEKRQSP", "matrix": [[-0.28, -0.24, 0.04, 0.17, 0.01, -0.03, -0.01],[0.06, -0.19, -0.00, 0.01, 0.07, -0.10, 0.21],[-0.00, 0.20, 0.00, -0.01, -0.07, -0.07, -0.11],[-0.01, -0.20, -0.03, 0.11, -0.10, 0.08, 0.15],[0.04, -0.17, 0.07, 0.01, -0.09, -0.07, -0.02],[-0.01, 0.35, -0.27, -0.16, 0.01, 0.43, -0.07],[-0.04, 0.01, 0.08, -0.00, 0.17, -0.06, -0.04]]},
+ {"i": 147,"j": 145, "score": 0.47, "iC": "DERHQNSTPGA", "jC": "DEKRQSGAY", "matrix": [[-0.18, -0.10, -0.14, -0.07, -0.08, -0.03, 0.07, 0.02, 0.28],[-0.04, -0.07, 0.07, 0.16, -0.04, 0.07, -0.06, -0.06, 0.02],[0.30, -0.04, 0.11, -0.01, -0.04, -0.05, -0.01, -0.03, -0.03],[-0.07, 0.35, -0.11, -0.06, 0.01, -0.04, -0.02, 0.04, -0.01],[0.10, -0.01, 0.08, -0.15, 0.05, -0.03, -0.07, -0.03, -0.04],[0.15, 0.02, -0.06, -0.00, -0.03, -0.00, -0.04, -0.01, 0.01],[0.01, -0.15, -0.04, 0.13, 0.15, -0.06, -0.09, 0.07, 0.01],[-0.10, -0.13, -0.09, -0.02, -0.01, 0.05, 0.26, -0.02, -0.03],[0.20, -0.03, -0.07, -0.16, 0.11, -0.05, -0.03, -0.07, -0.05],[-0.05, 0.34, -0.18, -0.16, -0.07, 0.15, -0.32, 0.33, -0.06],[-0.04, -0.06, 0.04, 0.16, -0.02, 0.01, 0.01, 0.05, -0.00]]},
+ {"i": 147,"j": 146, "score": 0.83, "iC": "DEQTPGAL", "jC": "DEKRHQNSTGAF", "matrix": [[-0.07, -0.26, -0.02, -0.08, -0.07, -0.02, -0.05, -0.03, -0.09, 0.53, -0.01, 0.16],[0.10, -0.05, -0.04, -0.01, -0.14, -0.06, 0.08, -0.06, -0.01, 0.26, -0.04, 0.00],[-0.04, -0.05, 0.03, -0.03, -0.06, 0.06, 0.01, -0.10, -0.02, 0.20, 0.04, -0.02],[0.15, 0.10, 0.07, -0.02, -0.04, -0.03, -0.13, -0.08, 0.08, -0.02, -0.04, -0.02],[-0.33, 0.04, -0.12, 0.15, -0.15, 0.22, 0.32, -0.11, -0.03, -0.29, -0.01, 0.11],[0.06, 0.04, 0.18, -0.04, -0.21, -0.13, 0.19, 0.37, 0.23, -0.46, 0.15, -0.20],[-0.09, 0.02, -0.06, -0.00, 0.57, 0.00, -0.28, -0.08, -0.01, -0.11, 0.00, -0.03],[-0.04, -0.01, -0.01, -0.01, 0.26, -0.02, -0.03, -0.02, -0.02, -0.01, -0.03, -0.01]]},
+ {"i": 147,"j": 148, "score": 0.78, "iC": "DEKRHQSTPGIL", "jC": "DEHTPAVILFWY", "matrix": [[-0.12, -0.09, 0.12, -0.04, -0.15, 0.09, -0.10, 0.13, 0.09, 0.12, -0.03, -0.06],[-0.06, -0.09, 0.02, -0.00, -0.06, 0.09, 0.10, -0.06, -0.14, 0.19, -0.07, 0.05],[0.01, 0.01, 0.06, 0.04, 0.04, -0.06, -0.04, -0.16, -0.08, 0.03, -0.03, 0.25],[0.25, 0.07, -0.12, 0.00, 0.04, -0.08, -0.10, -0.11, -0.07, -0.06, 0.06, 0.05],[0.06, 0.25, -0.09, -0.05, 0.06, -0.03, -0.07, -0.06, -0.07, -0.03, -0.03, -0.03],[0.03, -0.02, -0.12, -0.06, 0.06, -0.05, -0.12, 0.03, -0.03, 0.05, 0.04, 0.23],[-0.04, -0.02, 0.27, -0.02, 0.01, 0.20, 0.06, -0.02, 0.10, -0.15, -0.02, -0.39],[-0.01, -0.04, 0.14, -0.06, 0.18, 0.14, 0.01, 0.09, -0.12, -0.02, -0.01, -0.29],[-0.09, -0.09, 0.05, 0.02, -0.29, -0.03, -0.01, 0.06, -0.14, 0.02, 0.23, 0.31],[-0.12, -0.06, -0.19, 0.24, -0.30, -0.13, 0.30, 0.36, 0.53, -0.04, -0.03, -0.31],[0.03, 0.06, -0.07, -0.03, 0.03, 0.02, -0.06, -0.10, -0.10, 0.00, -0.02, 0.15],[-0.02, -0.02, 0.00, -0.02, 0.06, -0.03, -0.05, -0.09, -0.01, 0.01, -0.02, 0.19]]},
+ {"i": 147,"j": 149, "score": 0.39, "iC": "DRHPGAI", "jC": "DKRHQPGA", "matrix": [[0.15, -0.03, -0.09, 0.01, -0.04, -0.03, -0.17, -0.01],[-0.13, -0.05, -0.12, -0.05, -0.04, -0.04, 0.31, 0.16],[-0.15, 0.08, -0.01, -0.00, 0.01, -0.08, 0.30, -0.04],[0.28, -0.06, 0.04, 0.09, -0.11, 0.11, -0.17, -0.11],[-0.18, 0.23, 0.19, 0.17, 0.18, -0.38, -0.24, -0.21],[-0.01, -0.01, 0.06, -0.08, -0.06, 0.18, 0.11, 0.08],[-0.05, -0.02, 0.05, 0.00, 0.00, 0.18, 0.01, -0.04]]},
+ {"i": 148,"j": 117, "score": 0.64, "iC": "HAVILFWY", "jC": "DKRHQTGAL", "matrix": [[0.17, -0.14, -0.11, -0.19, -0.11, -0.10, 0.20, 0.22, 0.01],[0.05, 0.07, -0.02, -0.06, -0.06, -0.05, -0.09, 0.01, 0.24],[-0.03, 0.10, -0.03, -0.12, 0.11, -0.05, 0.06, 0.01, 0.33],[-0.07, 0.16, -0.08, -0.12, 0.11, -0.05, -0.05, -0.15, 0.19],[-0.01, 0.08, 0.10, -0.06, -0.02, 0.17, -0.14, 0.10, -0.20],[-0.10, 0.04, -0.03, 0.12, -0.08, 0.36, 0.02, 0.11, -0.28],[-0.05, -0.02, -0.06, 0.27, 0.01, 0.04, -0.03, 0.01, -0.09],[-0.10, -0.31, -0.23, 0.50, -0.23, 0.09, 0.10, 0.41, -0.28]]},
+ {"i": 148,"j": 119, "score": 0.60, "iC": "EHPAVLFWY", "jC": "PAVILFY", "matrix": [[-0.05, 0.00, 0.13, -0.02, -0.00, -0.17, 0.13],[-0.04, -0.04, 0.22, -0.08, -0.04, 0.04, -0.05],[0.01, 0.13, -0.10, -0.02, -0.04, -0.24, 0.14],[0.22, -0.05, 0.03, -0.11, -0.11, -0.17, 0.13],[0.06, -0.03, -0.01, -0.17, -0.11, 0.03, 0.37],[-0.21, 0.12, -0.17, -0.01, 0.02, -0.00, -0.07],[-0.00, -0.10, 0.15, 0.27, 0.05, 0.15, -0.40],[-0.09, -0.04, -0.05, 0.03, -0.00, 0.20, -0.03],[-0.19, -0.18, 0.04, 0.24, 0.42, 0.41, -0.43]]},
+ {"i": 148,"j": 146, "score": 0.66, "iC": "EHTPAVILFY", "jC": "DEKHNSTGAV", "matrix": [[0.03, 0.06, 0.01, -0.03, -0.16, -0.01, -0.01, -0.03, -0.02, 0.04],[0.07, -0.07, -0.00, 0.11, 0.23, -0.08, -0.03, -0.17, -0.02, -0.03],[0.16, -0.04, -0.04, -0.02, 0.16, -0.09, 0.02, -0.04, -0.02, -0.02],[-0.13, 0.16, 0.03, -0.10, -0.33, 0.00, 0.11, 0.37, 0.03, -0.01],[0.29, 0.06, 0.05, -0.03, -0.15, -0.12, -0.09, 0.06, -0.04, -0.00],[0.09, -0.04, 0.04, 0.04, -0.22, 0.08, 0.06, 0.13, 0.04, -0.04],[-0.12, 0.01, 0.22, -0.18, 0.15, 0.16, 0.04, -0.10, 0.05, -0.05],[-0.06, -0.02, -0.15, -0.31, -0.03, 0.27, 0.19, -0.06, 0.04, -0.02],[-0.11, -0.04, -0.10, 0.12, 0.28, -0.18, -0.12, -0.15, -0.01, 0.15],[-0.04, -0.05, -0.16, 0.23, 0.42, 0.03, -0.11, 0.03, -0.17, -0.02]]},
+ {"i": 148,"j": 147, "score": 0.78, "iC": "DEHTPAVILFWY", "jC": "DEKRHQSTPGIL", "matrix": [[-0.12, -0.06, 0.01, 0.25, 0.06, 0.03, -0.04, -0.01, -0.09, -0.12, 0.03, -0.02],[-0.09, -0.09, 0.01, 0.07, 0.25, -0.02, -0.02, -0.04, -0.09, -0.06, 0.06, -0.02],[0.12, 0.02, 0.06, -0.12, -0.09, -0.12, 0.27, 0.14, 0.05, -0.19, -0.07, 0.00],[-0.04, -0.00, 0.04, 0.00, -0.05, -0.06, -0.02, -0.06, 0.02, 0.24, -0.03, -0.02],[-0.15, -0.06, 0.04, 0.04, 0.06, 0.06, 0.01, 0.18, -0.29, -0.30, 0.03, 0.06],[0.09, 0.09, -0.06, -0.08, -0.03, -0.05, 0.20, 0.14, -0.03, -0.13, 0.02, -0.03],[-0.10, 0.10, -0.04, -0.10, -0.07, -0.12, 0.06, 0.01, -0.01, 0.30, -0.06, -0.05],[0.13, -0.06, -0.16, -0.11, -0.06, 0.03, -0.02, 0.09, 0.06, 0.36, -0.10, -0.09],[0.09, -0.14, -0.08, -0.07, -0.07, -0.03, 0.10, -0.12, -0.14, 0.53, -0.10, -0.01],[0.12, 0.19, 0.03, -0.06, -0.03, 0.05, -0.15, -0.02, 0.02, -0.04, 0.00, 0.01],[-0.03, -0.07, -0.03, 0.06, -0.03, 0.04, -0.02, -0.01, 0.23, -0.03, -0.02, -0.02],[-0.06, 0.05, 0.25, 0.05, -0.03, 0.23, -0.39, -0.29, 0.31, -0.31, 0.15, 0.19]]},
+ {"i": 148,"j": 149, "score": 0.60, "iC": "DEHTPAILFWY", "jC": "DEKRNTPGAI", "matrix": [[-0.03, 0.18, -0.01, -0.04, -0.01, -0.03, -0.12, 0.29, -0.13, -0.01],[-0.04, 0.01, 0.01, -0.02, -0.01, 0.08, -0.08, 0.17, -0.04, -0.01],[-0.09, 0.04, -0.09, 0.08, 0.01, -0.04, 0.13, -0.19, 0.29, -0.02],[-0.13, 0.02, 0.04, 0.15, -0.05, 0.08, -0.06, 0.03, -0.06, -0.01],[-0.02, -0.05, -0.03, -0.08, -0.08, -0.10, -0.21, 0.14, 0.44, -0.02],[0.24, -0.04, 0.03, -0.07, 0.01, 0.02, -0.16, -0.05, -0.00, -0.01],[-0.20, -0.00, 0.12, 0.04, 0.02, -0.16, 0.42, -0.04, -0.12, -0.11],[-0.29, 0.09, 0.07, -0.02, -0.02, -0.04, -0.06, -0.01, -0.10, 0.17],[0.27, -0.12, -0.05, -0.23, 0.02, 0.22, -0.15, -0.09, 0.07, 0.02],[-0.06, -0.05, 0.04, -0.01, -0.03, -0.02, 0.27, -0.05, -0.04, -0.00],[0.17, -0.17, -0.16, 0.03, 0.16, 0.02, 0.11, -0.14, -0.08, -0.06]]},
+ {"i": 149,"j": 116, "score": 0.83, "iC": "DEKRQNSTPGA", "jC": "DEKRHNGA", "matrix": [[-0.23, -0.28, 0.05, -0.11, 0.32, 0.20, -0.10, 0.09],[-0.61, -0.32, 0.28, 0.20, -0.01, 0.36, 0.01, -0.04],[0.16, 0.26, -0.17, -0.05, -0.07, -0.13, 0.00, -0.06],[0.47, 0.21, -0.15, -0.09, -0.08, -0.15, -0.05, -0.12],[-0.16, -0.12, 0.32, 0.04, -0.10, 0.03, -0.06, -0.05],[0.23, 0.05, -0.14, -0.07, -0.02, -0.10, 0.02, 0.02],[0.13, -0.19, -0.15, -0.09, 0.20, 0.23, -0.03, -0.08],[-0.01, 0.01, -0.00, -0.04, 0.02, 0.19, 0.00, 0.04],[-0.09, 0.04, -0.12, -0.02, 0.02, -0.20, 0.39, 0.03],[0.32, 0.06, -0.02, 0.04, -0.15, -0.09, -0.03, -0.03],[-0.08, 0.12, -0.02, 0.05, 0.17, -0.19, -0.15, 0.15]]},
+ {"i": 149,"j": 140, "score": 0.40, "iC": "DKRNTPA", "jC": "DERHSGVFWY", "matrix": [[-0.19, -0.13, 0.21, 0.01, -0.19, 0.00, -0.14, 0.22, -0.01, 0.18],[0.02, 0.40, -0.08, -0.10, -0.06, -0.02, 0.02, -0.06, 0.00, -0.06],[0.16, -0.01, -0.01, -0.11, 0.10, 0.11, -0.03, -0.09, 0.18, -0.02],[0.00, -0.15, 0.02, 0.01, 0.02, -0.15, 0.02, 0.20, 0.03, 0.11],[0.02, 0.01, -0.02, -0.17, 0.18, -0.13, 0.08, -0.08, -0.03, -0.07],[-0.13, -0.02, -0.15, 0.15, 0.03, 0.15, 0.17, 0.02, -0.01, -0.05],[0.23, -0.04, -0.11, 0.27, -0.17, -0.09, -0.10, 0.11, -0.07, 0.10]]},
+ {"i": 149,"j": 141, "score": 0.54, "iC": "DKRQNSTPGA", "jC": "DEKRHSTPGAVLFW", "matrix": [[-0.39, -0.37, 0.32, 0.05, 0.17, 0.22, -0.01, -0.04, -0.04, -0.00, -0.11, 0.03, 0.19, -0.04],[0.11, 0.14, -0.03, -0.01, -0.01, 0.04, 0.07, -0.04, 0.10, -0.19, 0.01, -0.11, -0.02, -0.08],[-0.00, 0.22, -0.01, -0.04, -0.08, -0.05, -0.09, -0.16, -0.04, 0.04, 0.03, 0.03, 0.04, 0.31],[0.01, -0.06, -0.02, 0.02, -0.05, -0.02, 0.10, -0.16, 0.09, 0.00, 0.03, -0.04, 0.03, 0.05],[-0.08, -0.10, 0.09, -0.02, -0.07, 0.14, -0.01, -0.17, -0.05, 0.05, -0.03, 0.16, 0.03, -0.01],[0.16, 0.14, -0.07, -0.03, -0.09, -0.05, 0.06, 0.10, -0.01, -0.03, 0.01, -0.07, -0.02, -0.03],[-0.03, 0.01, -0.05, -0.05, -0.06, -0.03, 0.08, 0.11, -0.02, -0.10, 0.20, -0.04, -0.03, -0.02],[0.10, 0.12, -0.03, 0.15, -0.12, -0.09, 0.11, 0.34, -0.15, -0.01, -0.08, -0.11, -0.16, -0.04],[0.03, -0.14, -0.05, 0.02, 0.04, -0.04, 0.01, 0.04, -0.06, -0.00, -0.06, 0.14, -0.03, -0.19],[0.03, 0.07, -0.20, -0.14, 0.23, 0.12, -0.16, 0.19, 0.09, 0.20, -0.10, -0.01, -0.02, -0.09]]},
+ {"i": 149,"j": 142, "score": 1.04, "iC": "DEKRNSTPGA", "jC": "DEKRHTPAVI", "matrix": [[-0.05, -0.12, 0.75, 0.67, 0.24, -0.17, -0.51, 0.26, -0.40, -0.15],[-0.11, -0.05, 0.14, 0.12, 0.03, -0.05, -0.08, -0.23, -0.06, -0.00],[0.02, 0.12, -0.22, -0.06, -0.00, 0.05, -0.04, -0.08, 0.05, 0.14],[0.24, 0.19, -0.15, -0.09, -0.02, 0.13, -0.03, -0.22, 0.03, 0.04],[-0.07, -0.09, 0.27, -0.08, -0.05, 0.04, -0.22, 0.26, -0.06, -0.05],[0.06, -0.21, -0.11, -0.08, -0.09, 0.09, 0.14, 0.08, 0.08, 0.06],[-0.03, 0.07, 0.06, -0.12, -0.11, 0.27, 0.13, -0.23, 0.00, -0.03],[-0.02, 0.11, -0.49, -0.14, 0.06, -0.01, 0.07, 0.19, 0.31, 0.02],[-0.06, -0.02, 0.03, -0.03, -0.08, -0.08, 0.25, -0.02, 0.04, -0.01],[-0.01, -0.13, -0.16, -0.07, 0.05, -0.09, 0.23, 0.20, 0.08, -0.03]]},
+ {"i": 149,"j": 147, "score": 0.39, "iC": "DKRHQPGA", "jC": "DRHPGAI", "matrix": [[0.15, -0.13, -0.15, 0.28, -0.18, -0.01, -0.05],[-0.03, -0.05, 0.08, -0.06, 0.23, -0.01, -0.02],[-0.09, -0.12, -0.01, 0.04, 0.19, 0.06, 0.05],[0.01, -0.05, -0.00, 0.09, 0.17, -0.08, 0.00],[-0.04, -0.04, 0.01, -0.11, 0.18, -0.06, 0.00],[-0.03, -0.04, -0.08, 0.11, -0.38, 0.18, 0.18],[-0.17, 0.31, 0.30, -0.17, -0.24, 0.11, 0.01],[-0.01, 0.16, -0.04, -0.11, -0.21, 0.08, -0.04]]},
+ {"i": 149,"j": 148, "score": 0.60, "iC": "DEKRNTPGAI", "jC": "DEHTPAILFWY", "matrix": [[-0.03, -0.04, -0.09, -0.13, -0.02, 0.24, -0.20, -0.29, 0.27, -0.06, 0.17],[0.18, 0.01, 0.04, 0.02, -0.05, -0.04, -0.00, 0.09, -0.12, -0.05, -0.17],[-0.01, 0.01, -0.09, 0.04, -0.03, 0.03, 0.12, 0.07, -0.05, 0.04, -0.16],[-0.04, -0.02, 0.08, 0.15, -0.08, -0.07, 0.04, -0.02, -0.23, -0.01, 0.03],[-0.01, -0.01, 0.01, -0.05, -0.08, 0.01, 0.02, -0.02, 0.02, -0.03, 0.16],[-0.03, 0.08, -0.04, 0.08, -0.10, 0.02, -0.16, -0.04, 0.22, -0.02, 0.02],[-0.12, -0.08, 0.13, -0.06, -0.21, -0.16, 0.42, -0.06, -0.15, 0.27, 0.11],[0.29, 0.17, -0.19, 0.03, 0.14, -0.05, -0.04, -0.01, -0.09, -0.05, -0.14],[-0.13, -0.04, 0.29, -0.06, 0.44, -0.00, -0.12, -0.10, 0.07, -0.04, -0.08],[-0.01, -0.01, -0.02, -0.01, -0.02, -0.01, -0.11, 0.17, 0.02, -0.00, -0.06]]},
+ {"i": 149,"j": 150, "score": 0.37, "iC": "DRPA", "jC": "HTLY", "matrix": [[-0.27, -0.13, 0.19, 0.03],[0.17, -0.03, -0.07, -0.10],[0.43, 0.21, -0.26, -0.25],[0.16, 0.08, -0.15, -0.27]]},
+ {"i": 150,"j": 25, "score": 0.97, "iC": "HVLFY", "jC": "DEKNSTGA", "matrix": [[0.31, -0.34, -0.16, 0.53, 0.07, -0.06, 0.03, -0.30],[-0.03, 0.04, -0.02, -0.03, 0.03, 0.17, -0.04, -0.10],[-0.08, 0.03, 0.05, -0.10, -0.01, -0.06, -0.16, 0.12],[0.32, 0.22, 0.21, -0.63, 0.14, 0.11, -0.22, -0.21],[-0.28, 0.30, -0.05, 0.45, -0.25, -0.44, 0.48, 0.08]]},
+ {"i": 150,"j": 140, "score": 0.54, "iC": "HLMCFY", "jC": "RHSGAILFY", "matrix": [[-0.05, -0.23, -0.04, 0.44, 0.01, 0.06, 0.01, -0.17, -0.06],[0.29, -0.27, 0.01, -0.16, 0.01, -0.03, 0.01, -0.06, 0.11],[0.07, -0.08, -0.01, -0.10, -0.04, -0.01, 0.04, 0.03, 0.16],[0.05, -0.00, 0.15, -0.11, 0.03, -0.00, 0.01, -0.06, -0.05],[-0.12, 0.56, 0.07, -0.21, -0.15, -0.04, -0.22, 0.05, -0.06],[-0.23, 0.27, 0.01, 0.14, 0.08, -0.15, -0.04, 0.06, -0.08]]},
+ {"i": 150,"j": 149, "score": 0.37, "iC": "HTLY", "jC": "DRPA", "matrix": [[-0.27, 0.17, 0.43, 0.16],[-0.13, -0.03, 0.21, 0.08],[0.19, -0.07, -0.26, -0.15],[0.03, -0.10, -0.25, -0.27]]},
+ {"i": 150,"j": 152, "score": 0.42, "iC": "HTALMFWY", "jC": "VF", "matrix": [[-0.11, 0.25],[-0.06, -0.20],[0.08, -0.15],[-0.02, 0.27],[-0.03, 0.16],[0.15, -0.34],[0.19, -0.20],[-0.25, 0.19]]},
+ {"i": 151,"j": 114, "score": 0.40, "iC": "DERQSTAVY", "jC": "EKRHVILY", "matrix": [[0.33, -0.07, 0.15, -0.00, -0.04, -0.15, 0.00, -0.05],[-0.41, 0.24, -0.05, 0.13, -0.06, -0.18, -0.05, 0.05],[0.31, -0.27, -0.13, 0.20, 0.08, 0.05, -0.12, -0.05],[-0.20, 0.08, -0.10, -0.10, -0.00, 0.02, 0.03, -0.00],[0.00, 0.03, -0.08, -0.18, -0.01, 0.13, 0.21, -0.02],[-0.17, -0.00, 0.06, -0.11, 0.27, 0.05, -0.03, -0.18],[0.11, 0.04, 0.05, -0.16, -0.12, 0.14, -0.07, -0.03],[0.05, 0.00, 0.29, -0.09, -0.03, -0.06, -0.00, -0.05],[-0.12, -0.05, -0.05, -0.04, -0.06, -0.01, -0.01, 0.25]]},
+ {"i": 151,"j": 116, "score": 1.18, "iC": "DEKRHQNSTAVI", "jC": "DEKRHQNAL", "matrix": [[-0.41, -0.39, 0.16, 0.17, 0.34, 0.01, 0.18, 0.09, -0.12],[-0.16, -0.45, 0.30, 0.07, 0.19, -0.04, 0.01, -0.05, 0.05],[0.14, 0.13, -0.13, -0.05, -0.21, -0.07, 0.01, -0.06, 0.06],[0.42, 0.41, -0.20, 0.03, -0.63, 0.08, -0.06, -0.10, 0.19],[-0.03, 0.17, -0.08, -0.02, -0.01, 0.21, -0.11, -0.03, -0.06],[-0.02, -0.09, 0.10, -0.06, -0.22, -0.05, 0.08, 0.05, -0.01],[-0.10, 0.15, 0.02, -0.01, -0.03, -0.02, 0.09, 0.00, -0.05],[0.01, 0.01, -0.12, -0.02, 0.71, -0.09, -0.09, -0.17, -0.16],[0.16, 0.06, -0.19, -0.05, 0.82, -0.09, -0.01, 0.11, -0.21],[0.10, 0.05, -0.03, -0.04, -0.34, -0.06, -0.07, 0.23, -0.08],[-0.00, -0.10, 0.10, 0.03, -0.17, 0.03, -0.01, -0.01, 0.17],[-0.10, -0.01, 0.01, -0.01, -0.06, 0.04, -0.02, -0.01, 0.16]]},
+ {"i": 151,"j": 138, "score": 0.94, "iC": "DEKRSTA", "jC": "DEKRQSA", "matrix": [[-0.06, -0.22, 0.10, 0.38, -0.05, -0.04, -0.06],[-0.11, -0.47, 0.01, 0.36, -0.11, 0.08, 0.04],[0.02, 0.19, -0.09, -0.24, 0.01, 0.03, -0.00],[0.20, 0.30, -0.24, -0.92, -0.07, 0.23, 0.11],[0.02, -0.07, -0.05, 0.30, -0.02, -0.32, -0.12],[-0.12, 0.09, 0.18, -0.26, 0.24, 0.22, 0.18],[-0.06, -0.04, -0.07, 0.31, -0.02, -0.07, -0.08]]},
+ {"i": 151,"j": 139, "score": 0.96, "iC": "DEKRSTAVCY", "jC": "DEKRHQNSPGVCF", "matrix": [[-0.26, -0.27, -0.07, 0.00, 0.77, -0.03, -0.03, 0.19, 0.04, -0.10, 0.13, -0.07, -0.14],[-0.21, -0.27, 0.22, 0.14, -0.12, 0.04, -0.03, -0.15, 0.20, 0.07, 0.12, -0.04, 0.01],[-0.07, 0.19, -0.07, -0.14, -0.03, -0.03, 0.03, 0.22, -0.03, -0.03, 0.00, 0.04, 0.01],[0.30, 0.21, -0.16, -0.30, -0.17, 0.11, -0.06, -0.04, -0.03, 0.26, -0.03, -0.06, -0.03],[0.64, -0.10, -0.03, 0.26, -0.07, -0.12, 0.19, -0.15, -0.23, -0.05, -0.16, -0.04, -0.02],[-0.25, 0.19, -0.12, 0.05, 0.10, -0.13, -0.11, 0.05, -0.05, -0.04, -0.11, -0.06, 0.20],[-0.10, 0.33, -0.09, 0.04, -0.14, 0.02, 0.02, -0.07, 0.00, 0.00, 0.06, -0.06, -0.08],[-0.16, -0.01, -0.01, -0.01, -0.05, -0.04, -0.02, -0.04, 0.20, -0.03, 0.07, -0.01, -0.03],[-0.06, -0.11, -0.01, -0.01, -0.05, 0.02, 0.04, 0.01, -0.06, -0.03, -0.05, 0.33, 0.09],[0.02, -0.04, 0.21, 0.02, -0.06, 0.16, -0.06, -0.10, -0.09, -0.02, -0.08, -0.03, 0.05]]},
+ {"i": 151,"j": 153, "score": 1.05, "iC": "DEKRQSTAVCY", "jC": "EKRQNSTVILFY", "matrix": [[-0.16, -0.13, -0.10, -0.06, 0.01, -0.04, -0.05, 0.67, 0.04, -0.03, 0.01, -0.03],[-0.51, 0.27, 0.40, 0.09, -0.06, -0.14, -0.03, 0.18, 0.13, 0.03, -0.08, -0.12],[0.04, -0.15, -0.13, 0.06, -0.06, -0.01, -0.05, 0.14, 0.21, 0.09, 0.03, -0.02],[0.20, -0.14, -0.25, -0.28, 0.05, -0.03, 0.07, -0.09, 0.06, 0.25, -0.04, -0.09],[0.01, 0.05, -0.09, 0.00, -0.04, -0.03, -0.01, 0.20, 0.03, 0.02, 0.03, -0.05],[-0.31, -0.11, -0.14, -0.02, 0.20, -0.10, -0.21, 0.15, 0.31, 0.07, -0.06, 0.03],[0.05, 0.19, 0.11, 0.07, -0.05, 0.21, -0.02, -0.66, -0.43, 0.11, 0.18, 0.35],[-0.04, -0.07, -0.09, -0.09, -0.04, 0.10, 0.13, 0.20, -0.05, -0.05, -0.03, -0.02],[0.32, 0.05, 0.01, 0.10, 0.00, 0.04, 0.02, -0.23, -0.06, -0.17, -0.03, -0.04],[0.17, 0.06, 0.02, 0.16, -0.01, -0.03, 0.03, -0.14, -0.06, -0.10, -0.01, -0.02],[0.11, -0.06, 0.27, 0.04, -0.03, -0.05, 0.07, -0.27, -0.06, -0.05, -0.04, -0.01]]},
+ {"i": 152,"j": 26, "score": 0.53, "iC": "FY", "jC": "DE", "matrix": [[0.44, -0.52],[-0.16, 0.14]]},
+ {"i": 152,"j": 29, "score": 0.69, "iC": "HVIFY", "jC": "RHNLFY", "matrix": [[-0.10, -0.13, -0.03, 0.03, 0.24, -0.03],[-0.17, 0.04, -0.01, 0.22, -0.05, -0.09],[-0.30, 0.38, 0.26, -0.10, 0.09, -0.28],[-0.04, 0.19, -0.05, -0.23, -0.00, 0.28],[0.66, -0.12, 0.02, -0.03, -0.35, 0.10]]},
+ {"i": 152,"j": 111, "score": 0.38, "iC": "VIFY", "jC": "EHVIF", "matrix": [[-0.18, -0.05, 0.27, 0.15, 0.04],[-0.30, -0.06, 0.18, 0.16, 0.04],[0.29, -0.04, -0.37, -0.29, 0.13],[0.21, 0.23, -0.09, 0.01, -0.19]]},
+ {"i": 152,"j": 150, "score": 0.42, "iC": "VF", "jC": "HTALMFWY", "matrix": [[-0.11, -0.06, 0.08, -0.02, -0.03, 0.15, 0.19, -0.25],[0.25, -0.20, -0.15, 0.27, 0.16, -0.34, -0.20, 0.19]]},
+ {"i": 153,"j": 114, "score": 1.49, "iC": "DEKRHQNSAVILMCY", "jC": "DEKRHTVILFY", "matrix": [[-0.03, -0.07, -0.04, 0.04, -0.04, 0.19, -0.05, -0.03, -0.05, -0.02, -0.02],[-0.16, -0.79, 0.05, 1.07, 0.08, 0.04, 0.19, -0.02, -0.14, -0.02, -0.14],[0.13, 0.49, -0.15, -0.46, 0.02, -0.02, -0.07, -0.05, -0.06, -0.02, 0.02],[0.26, 0.20, -0.40, -0.41, -0.08, -0.01, 0.05, -0.09, 0.00, 0.12, 0.45],[-0.03, 0.01, 0.20, 0.01, -0.04, -0.03, -0.01, 0.03, -0.03, -0.02, -0.04],[-0.02, -0.37, 0.03, 0.22, -0.10, 0.04, -0.05, -0.09, 0.16, -0.08, -0.12],[-0.02, 0.21, 0.01, -0.14, -0.03, 0.03, -0.02, 0.04, -0.00, -0.01, -0.03],[0.19, -0.13, 0.03, -0.12, 0.16, 0.13, 0.03, -0.03, -0.06, -0.04, -0.04],[-0.06, -0.09, -0.09, -0.24, 0.39, 0.06, -0.02, -0.05, -0.09, 0.14, 0.01],[-0.15, 0.64, -0.12, -0.45, 0.15, -0.13, -0.24, 0.09, -0.05, 0.29, 0.17],[-0.06, -0.10, 0.17, 0.16, -0.20, -0.06, 0.01, -0.02, 0.17, -0.10, -0.01],[-0.12, 0.04, 0.15, 0.16, -0.39, -0.17, -0.02, 0.20, 0.26, -0.21, -0.17],[-0.03, -0.03, -0.07, 0.19, -0.09, -0.03, 0.03, -0.01, 0.12, -0.05, 0.04],[-0.02, -0.02, 0.15, -0.02, 0.25, -0.04, -0.07, 0.06, -0.10, -0.05, -0.02],[-0.03, -0.06, 0.18, -0.01, -0.08, -0.04, 0.22, 0.02, -0.05, -0.04, -0.08]]},
+ {"i": 153,"j": 135, "score": 1.37, "iC": "EKRHQNTAVILMCY", "jC": "EKRPAVILMC", "matrix": [[-0.56, 0.22, 0.43, -0.08, -0.06, -0.22, -0.18, 0.38, 0.03, 0.08],[0.17, -0.27, -0.12, -0.04, -0.00, 0.06, -0.09, 0.23, -0.05, 0.11],[0.11, -0.14, -0.11, 0.04, -0.03, -0.03, -0.12, 0.36, 0.09, -0.06],[0.31, -0.06, -0.05, -0.04, -0.04, -0.09, 0.00, -0.13, -0.00, 0.00],[-0.21, -0.09, -0.08, -0.04, -0.04, -0.06, -0.04, 0.55, 0.14, -0.05],[-0.16, -0.00, 0.02, 0.01, -0.03, 0.01, -0.01, 0.23, 0.00, 0.00],[-0.05, 0.10, -0.09, 0.16, 0.05, 0.06, -0.12, -0.33, 0.13, 0.05],[0.01, 0.21, 0.05, -0.02, -0.08, -0.18, -0.08, -0.04, 0.06, 0.06],[0.52, 0.11, -0.03, 0.14, 0.30, 0.18, 0.12, -1.05, -0.18, -0.24],[0.21, 0.01, -0.10, 0.03, 0.06, 0.13, 0.23, -0.58, -0.03, -0.14],[-0.10, -0.20, -0.15, -0.10, -0.05, 0.23, 0.24, 0.33, -0.07, -0.04],[-0.15, -0.00, -0.01, 0.00, 0.03, 0.03, 0.02, 0.05, -0.03, -0.00],[-0.14, 0.08, 0.06, 0.00, -0.05, -0.17, -0.08, 0.15, 0.01, 0.16],[-0.03, -0.01, -0.01, -0.03, 0.03, 0.04, 0.14, -0.17, -0.03, 0.02]]},
+ {"i": 153,"j": 138, "score": 0.74, "iC": "EKRQSVILCY", "jC": "DEKRHST", "matrix": [[-0.15, -0.41, 0.02, 0.06, -0.09, 0.36, 0.17],[0.03, 0.20, -0.15, -0.38, -0.06, 0.16, 0.07],[0.14, 0.15, -0.16, -0.19, -0.02, -0.02, -0.00],[0.01, 0.29, -0.08, -0.28, -0.03, -0.01, -0.01],[-0.01, -0.05, -0.03, -0.06, 0.18, -0.02, -0.03],[-0.05, -0.07, -0.09, 0.68, -0.04, -0.08, -0.01],[-0.01, -0.08, 0.21, 0.27, 0.01, -0.25, 0.00],[0.02, -0.04, 0.15, 0.30, 0.02, -0.16, -0.06],[-0.04, 0.01, 0.11, 0.09, -0.05, -0.23, -0.04],[0.01, -0.04, 0.13, -0.15, -0.01, -0.08, -0.01]]},
+ {"i": 153,"j": 151, "score": 1.05, "iC": "EKRQNSTVILFY", "jC": "DEKRQSTAVCY", "matrix": [[-0.16, -0.51, 0.04, 0.20, 0.01, -0.31, 0.05, -0.04, 0.32, 0.17, 0.11],[-0.13, 0.27, -0.15, -0.14, 0.05, -0.11, 0.19, -0.07, 0.05, 0.06, -0.06],[-0.10, 0.40, -0.13, -0.25, -0.09, -0.14, 0.11, -0.09, 0.01, 0.02, 0.27],[-0.06, 0.09, 0.06, -0.28, 0.00, -0.02, 0.07, -0.09, 0.10, 0.16, 0.04],[0.01, -0.06, -0.06, 0.05, -0.04, 0.20, -0.05, -0.04, 0.00, -0.01, -0.03],[-0.04, -0.14, -0.01, -0.03, -0.03, -0.10, 0.21, 0.10, 0.04, -0.03, -0.05],[-0.05, -0.03, -0.05, 0.07, -0.01, -0.21, -0.02, 0.13, 0.02, 0.03, 0.07],[0.67, 0.18, 0.14, -0.09, 0.20, 0.15, -0.66, 0.20, -0.23, -0.14, -0.27],[0.04, 0.13, 0.21, 0.06, 0.03, 0.31, -0.43, -0.05, -0.06, -0.06, -0.06],[-0.03, 0.03, 0.09, 0.25, 0.02, 0.07, 0.11, -0.05, -0.17, -0.10, -0.05],[0.01, -0.08, 0.03, -0.04, 0.03, -0.06, 0.18, -0.03, -0.03, -0.01, -0.04],[-0.03, -0.12, -0.02, -0.09, -0.05, 0.03, 0.35, -0.02, -0.04, -0.02, -0.01]]},
+ {"i": 153,"j": 154, "score": 0.39, "iC": "EKSVIL", "jC": "DEQNTVIL", "matrix": [[-0.10, -0.26, 0.04, -0.08, 0.09, 0.01, 0.19, -0.09],[-0.02, -0.06, 0.01, -0.03, -0.24, 0.12, 0.03, 0.05],[-0.03, -0.05, -0.02, -0.03, -0.05, 0.05, 0.12, 0.17],[0.21, 0.15, -0.21, 0.07, 0.19, -0.17, -0.15, -0.07],[0.18, 0.01, 0.15, 0.33, 0.16, -0.25, -0.34, -0.13],[-0.02, 0.28, 0.07, -0.15, 0.23, -0.10, -0.16, -0.15]]},
+ {"i": 153,"j": 155, "score": 1.07, "iC": "EKRQTAVILCY", "jC": "LFWY", "matrix": [[-0.13, -0.30, 0.66, -0.22],[0.05, 0.27, -0.14, -0.13],[0.18, 0.05, -0.19, -0.01],[-0.06, 0.23, 0.47, -0.60],[-0.12, -0.14, 0.48, -0.22],[-0.15, 0.06, -0.09, 0.20],[0.08, -0.18, -0.34, 0.26],[0.14, -0.02, -0.27, 0.06],[0.30, -0.03, -0.37, 0.11],[-0.15, 0.12, -0.10, 0.16],[-0.06, -0.01, -0.13, 0.23]]},
+ {"i": 154,"j": 29, "score": 0.97, "iC": "DEKHQNTVIF", "jC": "RHFWY", "matrix": [[0.64, -0.19, -0.21, -0.04, -0.18],[-0.20, 0.40, -0.16, -0.06, -0.12],[-0.12, -0.10, 0.24, 0.01, -0.02],[-0.06, 0.09, 0.14, -0.02, -0.20],[-0.11, -0.09, 0.15, 0.04, -0.06],[0.29, 0.00, -0.11, -0.04, -0.08],[0.40, 0.39, 0.00, -0.25, -0.27],[-0.36, -0.30, -0.32, 0.15, 0.70],[-0.15, -0.37, -0.11, 0.40, 0.16],[-0.06, -0.03, 0.20, -0.01, -0.06]]},
+ {"i": 154,"j": 109, "score": 1.21, "iC": "DEKRHSTVILM", "jC": "DEKRHNTAVICY", "matrix": [[-0.01, -0.10, 0.07, -0.01, 0.20, -0.03, -0.07, 0.05, -0.10, -0.04, -0.02, -0.00],[-0.10, -0.39, 0.67, 0.09, 0.08, -0.04, 0.01, -0.08, -0.05, -0.03, -0.04, 0.02],[-0.05, 0.23, -0.44, -0.48, -0.04, -0.00, 0.20, -0.00, 0.28, 0.23, 0.05, 0.08],[0.06, 0.27, -0.32, -0.54, -0.14, -0.04, 0.22, 0.24, 0.25, -0.00, -0.01, -0.01],[0.55, 0.30, -0.18, -0.36, -0.04, 0.08, -0.12, -0.05, -0.09, -0.03, -0.03, -0.04],[-0.02, -0.07, -0.02, 0.23, 0.02, -0.02, -0.03, -0.03, -0.06, -0.03, -0.03, -0.02],[-0.27, -0.21, 0.20, 0.10, -0.17, -0.01, 0.37, -0.10, 0.12, 0.12, 0.16, -0.16],[-0.10, -0.05, 0.21, 0.46, -0.02, -0.07, -0.09, -0.04, -0.11, -0.04, 0.03, 0.00],[-0.07, -0.20, 0.23, 0.28, -0.10, -0.06, -0.07, -0.05, -0.05, -0.12, -0.01, 0.09],[-0.03, -0.09, -0.16, -0.11, 0.19, 0.21, -0.20, 0.04, -0.04, 0.00, -0.03, 0.09],[-0.02, -0.07, -0.15, 0.31, -0.05, 0.00, -0.08, -0.03, 0.08, 0.05, 0.00, -0.04]]},
+ {"i": 154,"j": 111, "score": 0.88, "iC": "DEKRQSTVIL", "jC": "ERHQILCFY", "matrix": [[-0.34, 0.23, 0.13, -0.06, -0.09, -0.04, 0.17, 0.05, -0.08],[-0.32, -0.08, -0.10, 0.19, 0.06, 0.19, 0.00, 0.06, -0.05],[-0.03, -0.03, 0.18, -0.02, -0.10, -0.06, -0.01, -0.02, 0.17],[0.55, -0.05, -0.03, -0.05, -0.03, 0.03, -0.05, -0.06, -0.23],[-0.02, -0.02, -0.04, 0.05, 0.00, -0.10, -0.01, 0.01, 0.17],[0.53, -0.04, -0.03, -0.02, -0.07, 0.01, -0.02, -0.03, -0.29],[0.54, -0.10, 0.01, -0.03, 0.09, 0.04, -0.13, -0.22, -0.15],[-0.32, 0.01, 0.02, -0.05, 0.12, -0.19, 0.04, 0.06, 0.39],[-0.19, -0.07, -0.01, 0.00, -0.07, -0.14, -0.00, 0.00, 0.49],[-0.13, -0.04, 0.08, -0.01, -0.15, 0.14, -0.01, 0.08, -0.01]]},
+ {"i": 154,"j": 137, "score": 0.67, "iC": "DERHQTVI", "jC": "DEKRSGALFW", "matrix": [[-0.03, -0.25, 0.05, -0.00, -0.23, 0.00, 0.05, 0.11, 0.12, 0.02],[-0.09, -0.31, 0.20, 0.10, 0.06, 0.04, -0.08, 0.01, -0.06, 0.00],[0.16, 0.23, -0.13, -0.06, -0.00, -0.15, -0.01, -0.03, -0.06, 0.26],[0.14, 0.04, -0.09, -0.02, 0.17, 0.02, -0.07, -0.02, -0.03, -0.03],[-0.05, -0.17, 0.02, 0.00, 0.07, 0.04, 0.02, 0.03, -0.02, 0.06],[0.29, 0.38, -0.12, -0.28, -0.44, 0.07, 0.38, -0.15, -0.03, -0.24],[0.02, -0.00, 0.15, 0.02, 0.45, -0.03, -0.24, -0.01, -0.08, -0.14],[-0.10, -0.08, 0.01, -0.02, 0.06, 0.01, -0.05, 0.01, 0.25, -0.04]]},
+ {"i": 154,"j": 153, "score": 0.39, "iC": "DEQNTVIL", "jC": "EKSVIL", "matrix": [[-0.10, -0.02, -0.03, 0.21, 0.18, -0.02],[-0.26, -0.06, -0.05, 0.15, 0.01, 0.28],[0.04, 0.01, -0.02, -0.21, 0.15, 0.07],[-0.08, -0.03, -0.03, 0.07, 0.33, -0.15],[0.09, -0.24, -0.05, 0.19, 0.16, 0.23],[0.01, 0.12, 0.05, -0.17, -0.25, -0.10],[0.19, 0.03, 0.12, -0.15, -0.34, -0.16],[-0.09, 0.05, 0.17, -0.07, -0.13, -0.15]]},
+ {"i": 154,"j": 156, "score": 0.90, "iC": "DEKRHQSTVILCY", "jC": "DEKRQSVIL", "matrix": [[-0.10, -0.01, -0.01, 0.04, -0.04, -0.11, 0.21, 0.13, -0.01],[-0.22, -0.46, -0.06, 0.34, -0.15, 0.08, 0.29, 0.08, -0.03],[-0.12, 0.18, -0.20, -0.22, -0.12, -0.02, 0.20, 0.03, 0.02],[0.09, 0.50, -0.09, -0.39, -0.15, -0.01, -0.05, 0.04, 0.05],[-0.08, -0.28, 0.02, 0.06, -0.00, -0.01, 0.14, 0.02, 0.08],[0.33, -0.17, -0.08, -0.11, 0.04, -0.02, -0.08, -0.00, -0.03],[-0.07, -0.26, -0.07, 0.14, 0.05, -0.00, 0.03, 0.04, 0.10],[-0.13, -0.21, 0.10, 0.06, -0.02, -0.20, 0.01, 0.02, 0.12],[0.29, 0.34, 0.19, 0.03, 0.13, -0.00, -0.32, -0.21, -0.17],[0.31, 0.15, 0.08, 0.01, 0.07, 0.03, -0.26, -0.14, -0.08],[-0.13, 0.10, 0.06, -0.03, -0.02, 0.15, -0.07, -0.04, -0.04],[-0.05, -0.05, -0.04, -0.06, 0.19, -0.00, -0.05, -0.02, 0.01],[-0.02, -0.05, 0.16, -0.03, 0.00, 0.02, -0.02, -0.02, -0.01]]},
+ {"i": 155,"j": 112, "score": 0.55, "iC": "LFWY", "jC": "RAVIL", "matrix": [[0.02, -0.15, -0.32, -0.20, 0.49],[0.19, 0.02, -0.08, -0.02, -0.04],[0.17, -0.07, 0.00, 0.01, -0.11],[-0.36, 0.15, 0.45, 0.17, -0.19]]},
+ {"i": 155,"j": 114, "score": 0.58, "iC": "LFWY", "jC": "DEKRHTVIFW", "matrix": [[0.06, 0.02, 0.20, -0.15, -0.15, 0.09, 0.06, 0.09, -0.14, -0.07],[0.19, -0.08, -0.04, -0.20, -0.29, 0.07, -0.11, 0.01, 0.33, -0.03],[-0.05, -0.19, -0.09, 0.22, -0.19, 0.05, 0.24, 0.05, -0.05, -0.07],[-0.18, 0.23, 0.06, 0.06, 0.57, -0.17, -0.22, -0.21, -0.18, 0.19]]},
+ {"i": 155,"j": 128, "score": 0.38, "iC": "LFWY", "jC": "VIFY", "matrix": [[-0.27, -0.13, -0.00, 0.45],[0.18, 0.05, -0.29, 0.06],[-0.10, 0.02, 0.20, -0.16],[0.20, 0.22, -0.03, -0.33]]},
+ {"i": 155,"j": 135, "score": 0.73, "iC": "LWY", "jC": "ERNSTVILC", "matrix": [[0.33, -0.16, 0.15, 0.18, 0.43, 0.17, 0.16, -0.59, -0.19],[-0.25, 0.31, 0.00, -0.05, -0.16, -0.21, -0.22, 0.28, 0.14],[-0.16, -0.05, -0.10, -0.15, -0.18, 0.08, -0.01, 0.36, 0.07]]},
+ {"i": 155,"j": 153, "score": 1.07, "iC": "LFWY", "jC": "EKRQTAVILCY", "matrix": [[-0.13, 0.05, 0.18, -0.06, -0.12, -0.15, 0.08, 0.14, 0.30, -0.15, -0.06],[-0.30, 0.27, 0.05, 0.23, -0.14, 0.06, -0.18, -0.02, -0.03, 0.12, -0.01],[0.66, -0.14, -0.19, 0.47, 0.48, -0.09, -0.34, -0.27, -0.37, -0.10, -0.13],[-0.22, -0.13, -0.01, -0.60, -0.22, 0.20, 0.26, 0.06, 0.11, 0.16, 0.23]]},
+ {"i": 156,"j": 109, "score": 1.22, "iC": "DEKRQVIL", "jC": "DEKRQTVIY", "matrix": [[-0.04, -0.15, -0.31, 0.93, -0.01, -0.05, -0.08, -0.08, -0.04],[-0.19, -0.51, 0.29, 0.70, -0.16, -0.08, 0.10, -0.14, 0.01],[0.01, 0.22, -0.29, -0.63, -0.08, 0.30, -0.04, 0.27, 0.18],[0.05, 0.42, -0.34, -0.44, 0.05, 0.11, 0.10, 0.01, 0.07],[-0.04, 0.03, -0.11, -0.09, 0.13, 0.08, -0.21, 0.10, 0.03],[0.05, 0.02, 0.22, 0.03, -0.04, -0.13, 0.08, -0.02, -0.09],[-0.01, 0.04, 0.23, -0.11, -0.04, -0.07, -0.04, 0.08, -0.01],[0.01, -0.06, 0.27, -0.04, 0.04, -0.09, -0.04, -0.05, -0.02]]},
+ {"i": 156,"j": 134, "score": 0.67, "iC": "DEKRHNT", "jC": "DEKRHQTI", "matrix": [[-0.11, -0.21, 0.11, 0.17, 0.04, -0.03, -0.07, -0.02],[-0.18, -0.42, 0.40, 0.53, 0.21, -0.20, 0.05, -0.22],[0.04, 0.40, -0.05, -0.23, -0.14, -0.10, -0.15, 0.09],[0.08, 0.42, -0.15, -0.39, -0.05, 0.03, -0.03, 0.03],[0.02, -0.01, -0.05, -0.07, 0.02, 0.16, -0.09, -0.01],[0.04, -0.04, -0.17, 0.03, -0.03, 0.05, 0.03, 0.02],[0.12, -0.15, 0.00, -0.26, 0.01, 0.05, 0.11, 0.08]]},
+ {"i": 156,"j": 136, "score": 1.04, "iC": "DEKRHQSTVI", "jC": "DEKSTAVIL", "matrix": [[-0.08, -0.19, 0.01, 0.21, 0.43, -0.01, -0.07, -0.08, -0.22],[-0.32, -0.74, 0.20, -0.10, 0.44, -0.11, 0.40, 0.31, 0.16],[-0.05, 0.08, -0.17, -0.10, -0.12, 0.00, 0.07, 0.13, 0.05],[0.07, 0.33, -0.08, -0.14, -0.08, 0.03, 0.16, -0.15, -0.01],[0.01, 0.09, 0.05, 0.00, -0.02, -0.09, 0.18, -0.10, -0.06],[-0.05, -0.22, -0.03, -0.09, 0.02, -0.22, 0.06, 0.36, 0.23],[0.16, 0.09, -0.04, 0.05, 0.02, -0.06, -0.12, -0.13, 0.02],[0.08, 0.16, 0.00, 0.19, -0.07, 0.05, -0.25, -0.17, -0.18],[0.05, 0.30, -0.01, -0.05, -0.23, 0.13, -0.23, -0.16, -0.15],[0.00, 0.10, 0.01, -0.05, -0.18, 0.17, -0.06, 0.06, 0.01]]},
+ {"i": 156,"j": 154, "score": 0.90, "iC": "DEKRQSVIL", "jC": "DEKRHQSTVILCY", "matrix": [[-0.10, -0.22, -0.12, 0.09, -0.08, 0.33, -0.07, -0.13, 0.29, 0.31, -0.13, -0.05, -0.02],[-0.01, -0.46, 0.18, 0.50, -0.28, -0.17, -0.26, -0.21, 0.34, 0.15, 0.10, -0.05, -0.05],[-0.01, -0.06, -0.20, -0.09, 0.02, -0.08, -0.07, 0.10, 0.19, 0.08, 0.06, -0.04, 0.16],[0.04, 0.34, -0.22, -0.39, 0.06, -0.11, 0.14, 0.06, 0.03, 0.01, -0.03, -0.06, -0.03],[-0.04, -0.15, -0.12, -0.15, -0.00, 0.04, 0.05, -0.02, 0.13, 0.07, -0.02, 0.19, 0.00],[-0.11, 0.08, -0.02, -0.01, -0.01, -0.02, -0.00, -0.20, -0.00, 0.03, 0.15, -0.00, 0.02],[0.21, 0.29, 0.20, -0.05, 0.14, -0.08, 0.03, 0.01, -0.32, -0.26, -0.07, -0.05, -0.02],[0.13, 0.08, 0.03, 0.04, 0.02, -0.00, 0.04, 0.02, -0.21, -0.14, -0.04, -0.02, -0.02],[-0.01, -0.03, 0.02, 0.05, 0.08, -0.03, 0.10, 0.12, -0.17, -0.08, -0.04, 0.01, -0.01]]}
+ ]
+}
\ No newline at end of file
diff --git a/dist/evzoom.js b/dist/evzoom.js
new file mode 100755
index 0000000..e1e86e0
--- /dev/null
+++ b/dist/evzoom.js
@@ -0,0 +1,4 @@
+!function(t,n){"object"==typeof exports&&"undefined"!=typeof module?n():"function"==typeof define&&define.amd?define(n):n()}(this,function(){"use strict";function t(t){return function(n,e){return $r(t(n),e)}}function n(t,n,e){var r=Math.abs(n-t)/Math.max(0,e),o=Math.pow(10,Math.floor(Math.log(r)/Math.LN10)),i=r/o;return i>=no?o*=10:i>=eo?o*=5:i>=ro&&(o*=2),n=0&&(e=t.slice(r+1),t=t.slice(0,r)),t&&!n.hasOwnProperty(t))throw new Error("unknown type: "+t);return{type:t,name:e}})}function i(t,n){for(var e,r=0,o=t.length;r=0&&(n=t.slice(e+1),t=t.slice(0,e)),{type:t,name:n}})}function f(t){return function(){var n=this.__on;if(n){for(var e,r=0,o=-1,i=n.length;rn?1:t>=n?0:NaN}function _(t){return function(){this.removeAttribute(t)}}function w(t){return function(){this.removeAttributeNS(t.space,t.local)}}function b(t,n){return function(){this.setAttribute(t,n)}}function M(t,n){return function(){this.setAttributeNS(t.space,t.local,n)}}function T(t,n){return function(){var e=n.apply(this,arguments);null==e?this.removeAttribute(t):this.setAttribute(t,e)}}function k(t,n){return function(){var e=n.apply(this,arguments);null==e?this.removeAttributeNS(t.space,t.local):this.setAttributeNS(t.space,t.local,e)}}function z(t){return function(){this.style.removeProperty(t)}}function S(t,n,e){return function(){this.style.setProperty(t,n,e)}}function C(t,n,e){return function(){var r=n.apply(this,arguments);null==r?this.style.removeProperty(t):this.style.setProperty(t,r,e)}}function N(t){return function(){delete this[t]}}function A(t,n){return function(){this[t]=n}}function j(t,n){return function(){var e=n.apply(this,arguments);null==e?delete this[t]:this[t]=e}}function D(t){return t.trim().split(/^|\s+/)}function L(t){return t.classList||new E(t)}function E(t){this._node=t,this._names=D(t.getAttribute("class")||"")}function Y(t,n){for(var e=L(t),r=-1,o=n.length;++r>8&15|n>>4&240,n>>4&15|240&n,(15&n)<<4|15&n,1)):(n=di.exec(t))?ot(parseInt(n[1],16)):(n=pi.exec(t))?new st(n[1],n[2],n[3],1):(n=gi.exec(t))?new st(255*n[1]/100,255*n[2]/100,255*n[3]/100,1):(n=yi.exec(t))?it(n[1],n[2],n[3],n[4]):(n=mi.exec(t))?it(255*n[1]/100,255*n[2]/100,255*n[3]/100,n[4]):(n=vi.exec(t))?lt(n[1],n[2]/100,n[3]/100,1):(n=xi.exec(t))?lt(n[1],n[2]/100,n[3]/100,n[4]):_i.hasOwnProperty(t)?ot(_i[t]):"transparent"===t?new st(NaN,NaN,NaN,0):null}function ot(t){return new st(t>>16&255,t>>8&255,255&t,1)}function it(t,n,e,r){return r<=0&&(t=n=e=NaN),new st(t,n,e,r)}function at(t){return t instanceof et||(t=rt(t)),t?(t=t.rgb(),new st(t.r,t.g,t.b,t.opacity)):new st}function ut(t,n,e,r){return 1===arguments.length?at(t):new st(t,n,e,null==r?1:r)}function st(t,n,e,r){this.r=+t,this.g=+n,this.b=+e,this.opacity=+r}function lt(t,n,e,r){return r<=0?t=n=e=NaN:e<=0||e>=1?t=n=NaN:n<=0&&(t=NaN),new ft(t,n,e,r)}function ct(t){if(t instanceof ft)return new ft(t.h,t.s,t.l,t.opacity);if(t instanceof et||(t=rt(t)),!t)return new ft;if(t instanceof ft)return t;t=t.rgb();var n=t.r/255,e=t.g/255,r=t.b/255,o=Math.min(n,e,r),i=Math.max(n,e,r),a=NaN,u=i-o,s=(i+o)/2;return u?(a=n===i?(e-r)/u+6*(e0&&s<1?0:a,new ft(a,u,s,t.opacity)}function ht(t,n,e,r){return 1===arguments.length?ct(t):new ft(t,n,e,null==r?1:r)}function ft(t,n,e,r){this.h=+t,this.s=+n,this.l=+e,this.opacity=+r}function dt(t,n,e){return 255*(t<60?n+(e-n)*t/60:t<180?e:t<240?n+(e-n)*(240-t)/60:n)}function pt(t){if(t instanceof yt)return new yt(t.l,t.a,t.b,t.opacity);if(t instanceof Mt){var n=t.h*wi;return new yt(t.l,Math.cos(n)*t.c,Math.sin(n)*t.c,t.opacity)}t instanceof st||(t=at(t));var e=_t(t.r),r=_t(t.g),o=_t(t.b),i=mt((.4124564*e+.3575761*r+.1804375*o)/Ti),a=mt((.2126729*e+.7151522*r+.072175*o)/ki),u=mt((.0193339*e+.119192*r+.9503041*o)/zi);return new yt(116*a-16,500*(i-a),200*(a-u),t.opacity)}function gt(t,n,e,r){return 1===arguments.length?pt(t):new yt(t,n,e,null==r?1:r)}function yt(t,n,e,r){this.l=+t,this.a=+n,this.b=+e,this.opacity=+r}function mt(t){return t>Ai?Math.pow(t,1/3):t/Ni+Si}function vt(t){return t>Ci?t*t*t:Ni*(t-Si)}function xt(t){return 255*(t<=.0031308?12.92*t:1.055*Math.pow(t,1/2.4)-.055)}function _t(t){return(t/=255)<=.04045?t/12.92:Math.pow((t+.055)/1.055,2.4)}function wt(t){if(t instanceof Mt)return new Mt(t.h,t.c,t.l,t.opacity);t instanceof yt||(t=pt(t));var n=Math.atan2(t.b,t.a)*bi;return new Mt(n<0?n+360:n,Math.sqrt(t.a*t.a+t.b*t.b),t.l,t.opacity)}function bt(t,n,e,r){return 1===arguments.length?wt(t):new Mt(t,n,e,null==r?1:r)}function Mt(t,n,e,r){this.h=+t,this.c=+n,this.l=+e,this.opacity=+r}function Tt(t){if(t instanceof zt)return new zt(t.h,t.s,t.l,t.opacity);t instanceof st||(t=at(t));var n=t.r/255,e=t.g/255,r=t.b/255,o=(Fi*r+Ui*n-Xi*e)/(Fi+Ui-Xi),i=r-o,a=(Yi*(e-o)-Li*i)/Ei,u=Math.sqrt(a*a+i*i)/(Yi*o*(1-o)),s=u?Math.atan2(a,i)*bi-120:NaN;return new zt(s<0?s+360:s,u,o,t.opacity)}function kt(t,n,e,r){return 1===arguments.length?Tt(t):new zt(t,n,e,null==r?1:r)}function zt(t,n,e,r){this.h=+t,this.s=+n,this.l=+e,this.opacity=+r}function St(t,n){return function(e){return t+e*n}}function Ct(t,n,e){return t=Math.pow(t,e),n=Math.pow(n,e)-t,e=1/e,function(r){return Math.pow(t+r*n,e)}}function Nt(t,n){var e=n-t;return e?St(t,e>180||e<-180?e-360*Math.round(e/360):e):Zi(isNaN(t)?n:t)}function At(t){return 1===(t=+t)?jt:function(n,e){return e-n?Ct(n,e,t):Zi(isNaN(n)?e:n)}}function jt(t,n){var e=n-t;return e?St(t,e):Zi(isNaN(t)?n:t)}function Dt(t){return function(){return t}}function Lt(t){return function(n){return t(n)+""}}function Et(t){return"none"===t?na:(Oi||(Oi=document.createElement("DIV"),Bi=document.documentElement,Hi=document.defaultView),Oi.style.transform=t,t=Hi.getComputedStyle(Bi.appendChild(Oi),null).getPropertyValue("transform"),Bi.removeChild(Oi),t=t.slice(7,-1).split(","),ea(+t[0],+t[1],+t[2],+t[3],+t[4],+t[5]))}function Yt(t){return null==t?na:(Pi||(Pi=document.createElementNS("http://www.w3.org/2000/svg","g")),Pi.setAttribute("transform",t),(t=Pi.transform.baseVal.consolidate())?(t=t.matrix,ea(t.a,t.b,t.c,t.d,t.e,t.f)):na)}function Ut(t,n,e,r){function o(t){return t.length?t.pop()+" ":""}function i(t,r,o,i,a,u){if(t!==o||r!==i){var s=a.push("translate(",null,n,null,e);u.push({i:s-4,x:Ri(t,o)},{i:s-2,x:Ri(r,i)})}else(o||i)&&a.push("translate("+o+n+i+e)}function a(t,n,e,i){t!==n?(t-n>180?n+=360:n-t>180&&(t+=360),i.push({i:e.push(o(e)+"rotate(",null,r)-2,x:Ri(t,n)})):n&&e.push(o(e)+"rotate("+n+r)}function u(t,n,e,i){t!==n?i.push({i:e.push(o(e)+"skewX(",null,r)-2,x:Ri(t,n)}):n&&e.push(o(e)+"skewX("+n+r)}function s(t,n,e,r,i,a){if(t!==e||n!==r){var u=i.push(o(i)+"scale(",null,",",null,")");a.push({i:u-4,x:Ri(t,e)},{i:u-2,x:Ri(n,r)})}else 1===e&&1===r||i.push(o(i)+"scale("+e+","+r+")")}return function(n,e){var r=[],o=[];return n=t(n),e=t(e),i(n.translateX,n.translateY,e.translateX,e.translateY,r,o),a(n.rotate,e.rotate,r,o),u(n.skewX,e.skewX,r,o),s(n.scaleX,n.scaleY,e.scaleX,e.scaleY,r,o),n=e=null,function(t){for(var n,e=-1,i=o.length;++e=0&&n._call.call(null,t),n=n._next;--sa}function Zt(){da=(fa=ga.now())+pa,sa=la=0;try{Pt()}finally{sa=0,It(),da=0}}function qt(){var t=ga.now(),n=t-fa;n>ha&&(pa-=n,fa=t)}function It(){for(var t,n,e=ia,r=1/0;e;)e._call?(r>e._time&&(r=e._time),t=e,e=e._next):(n=e._next,e._next=null,e=t?t._next=n:ia=n);aa=t,Wt(r)}function Wt(t){if(!sa){la&&(la=clearTimeout(la));var n=t-da;n>24?(t<1/0&&(la=setTimeout(Zt,n)),ca&&(ca=clearInterval(ca))):(ca||(fa=da,ca=setInterval(qt,ha)),sa=1,ya(Zt))}}function Rt(t,n){var e=t.__transition;if(!e||!(e=e[n])||e.state>_a)throw new Error("too late");return e}function Gt(t,n){var e=t.__transition;if(!e||!(e=e[n])||e.state>ba)throw new Error("too late");return e}function Vt(t,n){var e=t.__transition;if(!e||!(e=e[n]))throw new Error("too late");return e}function $t(t,n,e){function r(t){e.state=wa,e.timer.restart(o,e.delay,e.time),e.delay<=t&&o(t-e.delay)}function o(r){var l,c,h,f;if(e.state!==wa)return a();for(l in s)if(f=s[l],f.name===e.name){if(f.state===Ma)return ma(o);f.state===Ta?(f.state=za,f.timer.stop(),f.on.call("interrupt",t,t.__data__,f.index,f.group),delete s[l]):+l=0&&(t=t.slice(0,n)),!t||"start"===t})}function gn(t,n,e){var r,o,i=pn(n)?Rt:Gt;return function(){var a=i(this,t),u=a.on;u!==r&&(o=(r=u).copy()).on(n,e),a.on=o}}function yn(t){return function(){var n=this.parentNode;for(var e in this.__transition)if(+e!==t)return;n&&n.removeChild(this)}}function mn(t,n){var e,r,o;return function(){var i=qo(this).getComputedStyle(this,null),a=i.getPropertyValue(t),u=(this.style.removeProperty(t),i.getPropertyValue(t));return a===u?null:a===e&&u===r?o:o=n(e=a,r=u)}}function vn(t){return function(){this.style.removeProperty(t)}}function xn(t,n,e){var r,o;return function(){var i=qo(this).getComputedStyle(this,null).getPropertyValue(t);return i===e?null:i===r?o:o=n(r=i,e)}}function _n(t,n,e){var r,o,i;return function(){var a=qo(this).getComputedStyle(this,null),u=a.getPropertyValue(t),s=e(this);return null==s&&(this.style.removeProperty(t),s=a.getPropertyValue(t)),u===s?null:u===r&&s===o?i:i=n(r=u,o=s)}}function wn(t,n,e){function r(){var r=this,o=n.apply(r,arguments);return o&&function(n){r.style.setProperty(t,o(n),e)}}return r._value=n,r}function bn(t){return function(){this.textContent=t}}function Mn(t){return function(){var n=t(this);this.textContent=null==n?"":n}}function Tn(t,n,e,r){this._groups=t,this._parents=n,this._name=e,this._id=r}function kn(t){return tt().transition(t)}function zn(){return++Va}function Sn(t){return((t*=2)<=1?t*t*t:(t-=2)*t*t+2)/2}function Cn(t,n){for(var e;!(e=t.__transition)||!(e=e[n]);)if(!(t=t.parentNode))return eu.time=Ft(),eu;return e}function Nn(t){return{type:t}}function An(){this._x0=this._y0=this._x1=this._y1=null,this._=""}function jn(){return new An}function Dn(){}function Ln(t,n){var e=new Dn;if(t instanceof Dn)t.each(function(t,n){e.set(n,t)});else if(Array.isArray(t)){var r,o=-1,i=t.length;if(null==n)for(;++o=(i=(g+m)/2))?g=i:m=i,(c=e>=(a=(y+v)/2))?y=a:v=a,o=d,!(d=d[h=c<<1|l]))return o[h]=p,t;if(u=+t._x.call(null,d.data),s=+t._y.call(null,d.data),n===u&&e===s)return p.next=d,o?o[h]=p:t._root=p,t;do o=o?o[h]=new Array(4):t._root=new Array(4),(l=n>=(i=(g+m)/2))?g=i:m=i,(c=e>=(a=(y+v)/2))?y=a:v=a;while((h=c<<1|l)===(f=(s>=a)<<1|u>=i));return o[f]=d,o[h]=p,t}function Bn(t){var n,e,r,o,i=t.length,a=new Array(i),u=new Array(i),s=1/0,l=1/0,c=-(1/0),h=-(1/0);for(e=0;ec&&(c=r),oh&&(h=o));for(c",o=n[3]||"-",i=n[4]||"",a=!!n[5],u=n[6]&&+n[6],s=!!n[7],l=n[8]&&+n[8].slice(1),c=n[9]||"";"n"===c?(s=!0,c="g"):Uu[c]||(c=""),(a||"0"===e&&"="===r)&&(a=!0,e="0",r="="),this.fill=e,this.align=r,this.sign=o,this.symbol=i,this.zero=a,this.width=u,this.comma=s,this.precision=l,this.type=c}function Gn(t){return t}function Vn(t){return Ou=Zu(t),Bu=Ou.format,Hu=Ou.formatPrefix,Ou}function $n(){this.reset()}function Jn(t,n,e){var r=t.s=n+e,o=r-n,i=r-o;t.t=n-i+(e-o)}function Qn(t){return t>1?0:t<-1?$u:Math.acos(t)}function Kn(t){return t>1?Ju:t<-1?-Ju:Math.asin(t)}function te(){}function ne(t){var n=t[0],e=t[1],r=os(e);return[r*os(n),r*is(n),is(e)]}function ee(t,n){return[t[1]*n[2]-t[2]*n[1],t[2]*n[0]-t[0]*n[2],t[0]*n[1]-t[1]*n[0]]}function re(t){var n=as(t[0]*t[0]+t[1]*t[1]+t[2]*t[2]);t[0]/=n,t[1]/=n,t[2]/=n}function oe(t,n,e,r){this.x=t,this.z=n,this.o=e,this.e=r,this.v=!1,this.n=this.p=null}function ie(t){if(n=t.length){for(var n,e,r=0,o=t[0];++r1}function ue(t,n){return((t=t.x)[0]<0?t[1]-Ju-Vu:Ju-t[1])-((n=n.x)[0]<0?n[1]-Ju-Vu:Ju-n[1])}function se(t){var n,e=NaN,r=NaN,o=NaN;return{lineStart:function(){t.lineStart(),n=1},point:function(i,a){var u=i>0?$u:-$u,s=ns(i-e);ns(s-$u)0?Ju:-Ju),t.point(o,r),t.lineEnd(),t.lineStart(),t.point(u,r),t.point(i,r),n=0):o!==u&&s>=$u&&(ns(e-o)Vu?es((is(n)*(i=os(r))*is(e)-is(r)*(o=os(n))*is(t))/(o*i*a)):(n+r)/2}function ce(t,n,e,r){var o;if(null==t)o=e*Ju,r.point(-$u,o),r.point(0,o),r.point($u,o),r.point($u,0),r.point($u,-o),r.point(0,-o),r.point(-$u,-o),r.point(-$u,0),r.point(-$u,o);else if(ns(t[0]-n[0])>Vu){var i=t[0]=0;--i)l.push(r=e.children[i]=new xe(o[i])),r.parent=e,r.depth=e.depth+1;return u.eachBefore(ve)}function ge(){return pe(this).eachBefore(me)}function ye(t){return t.children}function me(t){t.data=t.data.data}function ve(t){var n=0;do t.height=n;while((t=t.parent)&&t.height<++n)}function xe(t){this.data=t,this.depth=this.height=0,this.parent=null}function _e(t,n){this._=t,this.parent=null,this.children=null,this.A=null,this.a=this,this.z=0,this.m=0,this.c=0,this.s=0,this.t=null,this.i=n}function we(t){if(!t._start)try{be(t)}catch(n){if(t._tasks[t._ended+t._active-1])Te(t,n);else if(!t._data)throw n}}function be(t){for(;t._start=t._waiting&&t._active=0;)if((e=t._tasks[r])&&(t._tasks[r]=null,e.abort))try{e.abort()}catch(t){}t._active=NaN,ke(t)}function ke(t){if(!t._active&&t._call){var n=t._data;t._data=void 0,t._call(t._error,n)}}function ze(t){return function(n,e){t(null==n?e:null)}}function Se(t){var n=t.responseType;return n&&"text"!==n?t.response:t.responseText}function Ce(t,n){return function(e){return t(e.responseText,n)}}function Ne(t,n){return(n-=t=+t)?function(e){return(e-t)/n}:Ls(n)}function Ae(t){return function(n,e){var r=t(n=+n,e=+e);return function(t){return t<=n?0:t>=e?1:r(t)}}}function je(t){return function(n,e){var r=t(n=+n,e=+e);return function(t){return t<=0?n:t>=1?e:r(t)}}}function De(t,n,e,r){var o=t[0],i=t[1],a=n[0],u=n[1];return i2?Le:De,i=a=null,r}function r(n){return(i||(i=o(u,s,c?Ae(t):t,l)))(+n)}var o,i,a,u=Ys,s=Ys,l=Qi,c=!1;return r.invert=function(t){return(a||(a=o(s,u,Ne,c?je(n):n)))(+t)},r.domain=function(t){return arguments.length?(u=js.call(t,Es),e()):u.slice()},r.range=function(t){return arguments.length?(s=Ds.call(t),e()):s.slice()},r.rangeRound=function(t){return s=Ds.call(t),l=Ki,e()},r.clamp=function(t){return arguments.length?(c=!!t,e()):c},r.interpolate=function(t){return arguments.length?(l=t,e()):l},e()}function Ue(t){var e=t.domain;return t.ticks=function(t){var n=e();return oo(n[0],n[n.length-1],null==t?10:t)},t.tickFormat=function(t,n){return Us(e(),t,n)},t.nice=function(r){var o=e(),i=o.length-1,a=null==r?10:r,u=o[0],s=o[i],l=n(u,s,a);return l&&(l=n(Math.floor(u/l)*l,Math.ceil(s/l)*l,a),o[0]=Math.floor(u/l)*l,o[i]=Math.ceil(s/l)*l,e(o)),t},t}function Xe(){var t=Ye(Ne,Ri);return t.copy=function(){return Ee(t,Xe())},Ue(t)}function Fe(t,n,e,r){function o(n){return t(n=new Date(+n)),n}return o.floor=o,o.ceil=function(e){return t(e=new Date(e-1)),n(e,1),t(e),e},o.round=function(t){var n=o(t),e=o.ceil(t);return t-n0))return a;do a.push(new Date(+e));while(n(e,i),t(e),e=n)for(;t(n),!e(n);)n.setTime(n-1)},function(t,r){if(t>=t)for(;--r>=0;)for(;n(t,1),!e(t););})},e&&(o.count=function(n,r){return Xs.setTime(+n),Fs.setTime(+r),t(Xs),t(Fs),Math.floor(e(Xs,Fs))},o.every=function(t){return t=Math.floor(t),isFinite(t)&&t>0?t>1?o.filter(r?function(n){return r(n)%t===0}:function(n){return o.count(0,n)%t===0}):o:null}),o}function Oe(t){return Fe(function(n){n.setDate(n.getDate()-(n.getDay()+7-t)%7),n.setHours(0,0,0,0)},function(t,n){t.setDate(t.getDate()+7*n)},function(t,n){return(n-t-(n.getTimezoneOffset()-t.getTimezoneOffset())*Hs)/qs})}function Be(t){return Fe(function(n){n.setUTCDate(n.getUTCDate()-(n.getUTCDay()+7-t)%7),n.setUTCHours(0,0,0,0)},function(t,n){t.setUTCDate(t.getUTCDate()+7*n)},function(t,n){return(n-t)/qs})}function He(t){if(0<=t.y&&t.y<100){var n=new Date(-1,t.m,t.d,t.H,t.M,t.S,t.L);return n.setFullYear(t.y),n}return new Date(t.y,t.m,t.d,t.H,t.M,t.S,t.L)}function Pe(t){if(0<=t.y&&t.y<100){var n=new Date(Date.UTC(-1,t.m,t.d,t.H,t.M,t.S,t.L));return n.setUTCFullYear(t.y),n}return new Date(Date.UTC(t.y,t.m,t.d,t.H,t.M,t.S,t.L))}function Ze(t){return{y:t,m:0,d:1,H:0,M:0,S:0,L:0}}function qe(t){function n(t,n){return function(e){var r,o,i,a=[],u=-1,s=0,l=t.length;for(e instanceof Date||(e=new Date(+e));++u=s)return-1;if(o=n.charCodeAt(a++),37===o){if(o=n.charAt(a++),i=P[o in ol?n.charAt(a++):o],!i||(r=i(t,e,r))<0)return-1}else if(o!=e.charCodeAt(r++))return-1}return r}function o(t,n,e){var r=A.exec(n.slice(e));return r?(t.p=j[r[0].toLowerCase()],e+r[0].length):-1}function i(t,n,e){var r=E.exec(n.slice(e));return r?(t.w=Y[r[0].toLowerCase()],e+r[0].length):-1}function a(t,n,e){var r=D.exec(n.slice(e));return r?(t.w=L[r[0].toLowerCase()],e+r[0].length):-1}function u(t,n,e){var r=F.exec(n.slice(e));return r?(t.m=O[r[0].toLowerCase()],e+r[0].length):-1}function s(t,n,e){var r=U.exec(n.slice(e));return r?(t.m=X[r[0].toLowerCase()],e+r[0].length):-1}function l(t,n,e){return r(t,b,n,e)}function c(t,n,e){return r(t,M,n,e)}function h(t,n,e){return r(t,T,n,e)}function f(t){return S[t.getDay()]}function d(t){return z[t.getDay()]}function p(t){return N[t.getMonth()]}function g(t){return C[t.getMonth()]}function y(t){return k[+(t.getHours()>=12)]}function m(t){return S[t.getUTCDay()]}function v(t){return z[t.getUTCDay()]}function x(t){return N[t.getUTCMonth()]}function _(t){return C[t.getUTCMonth()]}function w(t){return k[+(t.getUTCHours()>=12)]}var b=t.dateTime,M=t.date,T=t.time,k=t.periods,z=t.days,S=t.shortDays,C=t.months,N=t.shortMonths,A=Re(k),j=Ge(k),D=Re(z),L=Ge(z),E=Re(S),Y=Ge(S),U=Re(C),X=Ge(C),F=Re(N),O=Ge(N),B={a:f,A:d,b:p,B:g,c:null,d:lr,e:lr,H:cr,I:hr,j:fr,L:dr,m:pr,M:gr,p:y,S:yr,U:mr,w:vr,W:xr,x:null,X:null,y:_r,Y:wr,Z:br,"%":Xr},H={a:m,A:v,b:x,B:_,c:null,d:Mr,e:Mr,H:Tr,I:kr,j:zr,L:Sr,m:Cr,M:Nr,p:w,S:Ar,U:jr,w:Dr,W:Lr,x:null,X:null,y:Er,Y:Yr,Z:Ur,"%":Xr},P={a:i,A:a,b:u,B:s,c:l,d:er,e:er,H:or,I:or,j:rr,L:ur,m:nr,M:ir,p:o,S:ar,U:$e,w:Ve,W:Je,x:c,X:h,y:Ke,Y:Qe,Z:tr,"%":sr};return B.x=n(M,B),B.X=n(T,B),B.c=n(b,B),H.x=n(M,H),H.X=n(T,H),H.c=n(b,H),{format:function(t){var e=n(t+="",B);return e.toString=function(){return t},e},parse:function(t){var n=e(t+="",He);return n.toString=function(){return t},n},utcFormat:function(t){var e=n(t+="",H);return e.toString=function(){return t},e},utcParse:function(t){var n=e(t,Pe);return n.toString=function(){return t},n}}}function Ie(t,n,e){var r=t<0?"-":"",o=(r?-t:t)+"",i=o.length;return r+(i68?1900:2e3),e+r[0].length):-1}function tr(t,n,e){var r=/^(Z)|([+-]\d\d)(?:\:?(\d\d))?/.exec(n.slice(e,e+6));return r?(t.Z=r[1]?0:-(r[2]+(r[3]||"00")),e+r[0].length):-1}function nr(t,n,e){var r=il.exec(n.slice(e,e+2));return r?(t.m=r[0]-1,e+r[0].length):-1}function er(t,n,e){var r=il.exec(n.slice(e,e+2));return r?(t.d=+r[0],e+r[0].length):-1}function rr(t,n,e){var r=il.exec(n.slice(e,e+3));return r?(t.m=0,t.d=+r[0],e+r[0].length):-1}function or(t,n,e){var r=il.exec(n.slice(e,e+2));return r?(t.H=+r[0],e+r[0].length):-1}function ir(t,n,e){var r=il.exec(n.slice(e,e+2));return r?(t.M=+r[0],e+r[0].length):-1}function ar(t,n,e){var r=il.exec(n.slice(e,e+2));return r?(t.S=+r[0],e+r[0].length):-1}function ur(t,n,e){var r=il.exec(n.slice(e,e+3));return r?(t.L=+r[0],e+r[0].length):-1}function sr(t,n,e){var r=al.exec(n.slice(e,e+1));return r?e+r[0].length:-1}function lr(t,n){return Ie(t.getDate(),n,2)}function cr(t,n){return Ie(t.getHours(),n,2)}function hr(t,n){return Ie(t.getHours()%12||12,n,2)}function fr(t,n){return Ie(1+Is.count(Gs(t),t),n,3)}function dr(t,n){return Ie(t.getMilliseconds(),n,3)}function pr(t,n){return Ie(t.getMonth()+1,n,2)}function gr(t,n){return Ie(t.getMinutes(),n,2)}function yr(t,n){return Ie(t.getSeconds(),n,2)}function mr(t,n){return Ie(Ws.count(Gs(t),t),n,2)}function vr(t){return t.getDay()}function xr(t,n){return Ie(Rs.count(Gs(t),t),n,2)}function _r(t,n){return Ie(t.getFullYear()%100,n,2)}function wr(t,n){return Ie(t.getFullYear()%1e4,n,4)}function br(t){var n=t.getTimezoneOffset();return(n>0?"-":(n*=-1,"+"))+Ie(n/60|0,"0",2)+Ie(n%60,"0",2)}function Mr(t,n){return Ie(t.getUTCDate(),n,2)}function Tr(t,n){return Ie(t.getUTCHours(),n,2)}function kr(t,n){return Ie(t.getUTCHours()%12||12,n,2)}function zr(t,n){return Ie(1+Vs.count(Qs(t),t),n,3)}function Sr(t,n){return Ie(t.getUTCMilliseconds(),n,3)}function Cr(t,n){return Ie(t.getUTCMonth()+1,n,2)}function Nr(t,n){return Ie(t.getUTCMinutes(),n,2)}function Ar(t,n){return Ie(t.getUTCSeconds(),n,2)}function jr(t,n){return Ie($s.count(Qs(t),t),n,2);
+}function Dr(t){return t.getUTCDay()}function Lr(t,n){return Ie(Js.count(Qs(t),t),n,2)}function Er(t,n){return Ie(t.getUTCFullYear()%100,n,2)}function Yr(t,n){return Ie(t.getUTCFullYear()%1e4,n,4)}function Ur(){return"+0000"}function Xr(){return"%"}function Fr(t){return Ks=qe(t),tl=Ks.format,nl=Ks.parse,el=Ks.utcFormat,rl=Ks.utcParse,Ks}function Or(t){return t.toISOString()}function Br(t){var n=new Date(t);return isNaN(n)?null:n}function Hr(t){this._context=t}function Pr(t){return t<0?-1:1}function Zr(t,n,e){var r=t._x1-t._x0,o=n-t._x1,i=(t._y1-t._y0)/(r||o<0&&-0),a=(e-t._y1)/(o||r<0&&-0),u=(i*o+a*r)/(r+o);return(Pr(i)+Pr(a))*Math.min(Math.abs(i),Math.abs(a),.5*Math.abs(u))||0}function qr(t,n){var e=t._x1-t._x0;return e?(3*(t._y1-t._y0)/e-n)/2:n}function Ir(t,n,e){var r=t._x0,o=t._y0,i=t._x1,a=t._y1,u=(i-r)/3;t._context.bezierCurveTo(r+u,o+u*n,i-u,a-u*e,i,a)}function Wr(t){this._context=t}function Rr(t){this._context=new Gr(t)}function Gr(t){this._context=t}function Vr(t,n,e,r){return Math.sqrt((t-e)*(t-e)+(n-r)*(n-r))}var $r=function(t,n){return tn?1:t>=n?0:NaN},Jr=function(n){return 1===n.length&&(n=t(n)),{left:function(t,e,r,o){for(null==r&&(r=0),null==o&&(o=t.length);r>>1;n(t[i],e)<0?r=i+1:o=i}return r},right:function(t,e,r,o){for(null==r&&(r=0),null==o&&(o=t.length);r>>1;n(t[i],e)>0?o=i:r=i+1}return r}}},Qr=Jr($r),Kr=Qr.right,to=function(t,n,e){t=+t,n=+n,e=(o=arguments.length)<2?(n=t,t=0,1):o<3?1:+e;for(var r=-1,o=0|Math.max(0,Math.ceil((n-t)/e)),i=new Array(o);++r=0;)for(r=t[o],n=r.length;--n>=0;)e[--a]=r[n];return e},ao={value:function(){}};r.prototype=e.prototype={constructor:r,on:function(t,n){var e,r=this._,u=o(t+"",r),s=-1,l=u.length;{if(!(arguments.length<2)){if(null!=n&&"function"!=typeof n)throw new Error("invalid callback: "+n);for(;++s0)for(var e,r,o=new Array(e),i=0;i=0&&"xmlns"!==(n=t.slice(0,e))&&(t=t.slice(e+1)),so.hasOwnProperty(n)?{space:so[n],local:t}:t},co=function(t){var n=lo(t);return(n.local?s:u)(n)},ho=function(t){return function(){return this.matches(t)}};if("undefined"!=typeof document){var fo=document.documentElement;if(!fo.matches){var po=fo.webkitMatchesSelector||fo.msMatchesSelector||fo.mozMatchesSelector||fo.oMatchesSelector;ho=function(t){return function(){return po.call(this,t)}}}}var go=ho,yo={},mo=null;if("undefined"!=typeof document){var vo=document.documentElement;"onmouseenter"in vo||(yo={mouseenter:"mouseover",mouseleave:"mouseout"})}var xo=function(t,n,e){var r,o,i=h(t+""),a=i.length;{if(!(arguments.length<2)){for(u=n?d:f,null==e&&(e=!1),r=0;r=M&&(M=b+1);!(w=y[M])&&++M=0;)(r=o[i])&&(a&&a!==r.nextSibling&&a.parentNode.insertBefore(r,a),a=r);return this},Uo=function(t){function n(n,e){return n&&e?t(n.__data__,e.__data__):!n-!e}t||(t=x);for(var e=this._groups,r=e.length,o=new Array(r),i=0;i1?this.each((null==n?z:"function"==typeof n?C:S)(t,n,null==e?"":e)):qo(r=this.node()).getComputedStyle(r,null).getPropertyValue(t)},Wo=function(t,n){return arguments.length>1?this.each((null==n?N:"function"==typeof n?j:A)(t,n)):this.node()[t]};E.prototype={add:function(t){var n=this._names.indexOf(t);n<0&&(this._names.push(t),this._node.setAttribute("class",this._names.join(" ")))},remove:function(t){var n=this._names.indexOf(t);n>=0&&(this._names.splice(n,1),this._node.setAttribute("class",this._names.join(" ")))},contains:function(t){return this._names.indexOf(t)>=0}};var Ro=function(t,n){var e=D(t+"");if(arguments.length<2){for(var r=L(this.node()),o=-1,i=e.length;++o=240?t-240:t+120,o,r),dt(t,o,r),dt(t<120?t+240:t-120,o,r),this.opacity)},displayable:function(){return(0<=this.s&&this.s<=1||isNaN(this.s))&&0<=this.l&&this.l<=1&&0<=this.opacity&&this.opacity<=1}}));var wi=Math.PI/180,bi=180/Math.PI,Mi=18,Ti=.95047,ki=1,zi=1.08883,Si=4/29,Ci=6/29,Ni=3*Ci*Ci,Ai=Ci*Ci*Ci;ai(yt,gt,nt(et,{brighter:function(t){return new yt(this.l+Mi*(null==t?1:t),this.a,this.b,this.opacity)},darker:function(t){return new yt(this.l-Mi*(null==t?1:t),this.a,this.b,this.opacity)},rgb:function(){var t=(this.l+16)/116,n=isNaN(this.a)?t:t+this.a/500,e=isNaN(this.b)?t:t-this.b/200;return t=ki*vt(t),n=Ti*vt(n),e=zi*vt(e),new st(xt(3.2404542*n-1.5371385*t-.4985314*e),xt(-.969266*n+1.8760108*t+.041556*e),xt(.0556434*n-.2040259*t+1.0572252*e),this.opacity)}})),ai(Mt,bt,nt(et,{brighter:function(t){return new Mt(this.h,this.c,this.l+Mi*(null==t?1:t),this.opacity)},darker:function(t){return new Mt(this.h,this.c,this.l-Mi*(null==t?1:t),this.opacity)},rgb:function(){return pt(this).rgb()}}));var ji=-.14861,Di=1.78277,Li=-.29227,Ei=-.90649,Yi=1.97294,Ui=Yi*Ei,Xi=Yi*Di,Fi=Di*Li-Ei*ji;ai(zt,kt,nt(et,{brighter:function(t){return t=null==t?si:Math.pow(si,t),new zt(this.h,this.s,this.l*t,this.opacity)},darker:function(t){return t=null==t?ui:Math.pow(ui,t),new zt(this.h,this.s,this.l*t,this.opacity)},rgb:function(){var t=isNaN(this.h)?0:(this.h+120)*wi,n=+this.l,e=isNaN(this.s)?0:this.s*n*(1-n),r=Math.cos(t),o=Math.sin(t);return new st(255*(n+e*(ji*r+Di*o)),255*(n+e*(Li*r+Ei*o)),255*(n+e*(Yi*r)),this.opacity)}}));var Oi,Bi,Hi,Pi,Zi=function(t){return function(){return t}},qi=function t(n){function e(t,n){var e=r((t=ut(t)).r,(n=ut(n)).r),o=r(t.g,n.g),i=r(t.b,n.b),a=jt(t.opacity,n.opacity);return function(n){return t.r=e(n),t.g=o(n),t.b=i(n),t.opacity=a(n),t+""}}var r=At(n);return e.gamma=t,e}(1),Ii=function(t,n){var e,r=n?n.length:0,o=t?Math.min(r,t.length):0,i=new Array(r),a=new Array(r);for(e=0;ei&&(o=n.slice(i,o),u[a]?u[a]+=o:u[++a]=o),(e=e[0])===(r=r[0])?u[a]?u[a]+=r:u[++a]=r:(u[++a]=null,s.push({i:a,x:Ri(e,r)})),i=$i.lastIndex;return iba&&e.stateau)if(Math.abs(c*u-s*l)>au&&o){var f=e-i,d=r-a,p=u*u+s*s,g=f*f+d*d,y=Math.sqrt(p),m=Math.sqrt(h),v=o*Math.tan((ou-Math.acos((p+h-g)/(2*y*m)))/2),x=v/m,_=v/y;Math.abs(x-1)>au&&(this._+="L"+(t+x*l)+","+(n+x*c)),this._+="A"+o+","+o+",0,0,"+ +(c*f>l*d)+","+(this._x1=t+_*u)+","+(this._y1=n+_*s)}else this._+="L"+(this._x1=t)+","+(this._y1=n);else;},arc:function(t,n,e,r,o,i){t=+t,n=+n,e=+e;var a=e*Math.cos(r),u=e*Math.sin(r),s=t+a,l=n+u,c=1^i,h=i?r-o:o-r;if(e<0)throw new Error("negative radius: "+e);null===this._x1?this._+="M"+s+","+l:(Math.abs(this._x1-s)>au||Math.abs(this._y1-l)>au)&&(this._+="L"+s+","+l),e&&(h>uu?this._+="A"+e+","+e+",0,1,"+c+","+(t-a)+","+(n-u)+"A"+e+","+e+",0,1,"+c+","+(this._x1=s)+","+(this._y1=l):(h<0&&(h=h%iu+iu),this._+="A"+e+","+e+",0,"+ +(h>=ou)+","+c+","+(this._x1=t+e*Math.cos(o))+","+(this._y1=n+e*Math.sin(o))))},rect:function(t,n,e,r){this._+="M"+(this._x0=this._x1=+t)+","+(this._y0=this._y1=+n)+"h"+ +e+"v"+ +r+"h"+-e+"Z"},toString:function(){return this._}};var su="$";Dn.prototype=Ln.prototype={constructor:Dn,has:function(t){return su+t in this},get:function(t){return this[su+t]},set:function(t,n){return this[su+t]=n,this},remove:function(t){var n=su+t;return n in this&&delete this[n]},clear:function(){for(var t in this)t[0]===su&&delete this[t]},keys:function(){var t=[];for(var n in this)n[0]===su&&t.push(n.slice(1));return t},values:function(){var t=[];for(var n in this)n[0]===su&&t.push(this[n]);return t},entries:function(){var t=[];for(var n in this)n[0]===su&&t.push({key:n.slice(1),value:this[n]});return t},size:function(){var t=0;for(var n in this)n[0]===su&&++t;return t},empty:function(){for(var t in this)if(t[0]===su)return!1;return!0},each:function(t){for(var n in this)n[0]===su&&t(this[n],n.slice(1),this)}};var lu=Ln.prototype;En.prototype=Yn.prototype={constructor:En,has:lu.has,add:function(t){return t+="",this[su+t]=t,this},remove:lu.remove,clear:lu.clear,values:lu.keys,size:lu.size,empty:lu.empty,each:lu.each};var cu=function(t){function n(t,n){var r,o,i=e(t,function(t,e){return r?r(t,e-1):(o=t,void(r=n?Xn(t,n):Un(t)))});return i.columns=o,i}function e(t,n){function e(){if(c>=l)return a;if(o)return o=!1,i;var n,e=c;if(34===t.charCodeAt(e)){for(var r=e;r++t||t>o||r>n||n>i))return this;var a,u,s=o-e,l=this._root;switch(u=(n<(r+i)/2)<<1|t<(e+o)/2){case 0:do a=new Array(4),a[u]=l,l=a;while(s*=2,o=e+s,i=r+s,t>o||n>i);break;case 1:do a=new Array(4),a[u]=l,l=a;while(s*=2,e=o-s,i=r+s,e>t||n>i);break;case 2:do a=new Array(4),a[u]=l,l=a;while(s*=2,o=e+s,r=i-s,t>o||r>n);break;case 3:do a=new Array(4),a[u]=l,l=a;while(s*=2,e=o-s,r=i-s,e>t||r>n)}this._root&&this._root.length&&(this._root=l)}return this._x0=e,this._y0=r,this._x1=o,this._y1=i,this},mu=function(){var t=[];return this.visit(function(n){if(!n.length)do t.push(n.data);while(n=n.next)}),t},vu=function(t){return arguments.length?this.cover(+t[0][0],+t[0][1]).cover(+t[1][0],+t[1][1]):isNaN(this._x0)?void 0:[[this._x0,this._y0],[this._x1,this._y1]]},xu=function(t,n,e,r,o){this.node=t,this.x0=n,this.y0=e,this.x1=r,this.y1=o},_u=function(t,n,e){var r,o,i,a,u,s,l,c=this._x0,h=this._y0,f=this._x1,d=this._y1,p=[],g=this._root;for(g&&p.push(new xu(g,c,h,f,d)),null==e?e=1/0:(c=t-e,h=n-e,f=t+e,d=n+e,e*=e);s=p.pop();)if(!(!(g=s.node)||(o=s.x0)>f||(i=s.y0)>d||(a=s.x1)=m)<<1|t>=y)&&(s=p[p.length-1],p[p.length-1]=p[p.length-1-l],p[p.length-1-l]=s)}else{var v=t-+this._x.call(null,g.data),x=n-+this._y.call(null,g.data),_=v*v+x*x;if(_=(u=(p+y)/2))?p=u:y=u,(c=a>=(s=(g+m)/2))?g=s:m=s,n=d,!(d=d[h=c<<1|l]))return this;if(!d.length)break;(n[h+1&3]||n[h+2&3]||n[h+3&3])&&(e=n,f=h)}for(;d.data!==t;)if(r=d,!(d=d.next))return this;return(o=d.next)&&delete d.next,r?(o?r.next=o:delete r.next,this):n?(o?n[h]=o:delete n[h],(d=n[0]||n[1]||n[2]||n[3])&&d===(n[3]||n[2]||n[1]||n[0])&&!d.length&&(e?e[f]=d:this._root=d),this):(this._root=o,this)},bu=function(){return this._root},Mu=function(){var t=0;return this.visit(function(n){if(!n.length)do++t;while(n=n.next)}),t},Tu=function(t){var n,e,r,o,i,a,u=[],s=this._root;for(s&&u.push(new xu(s,this._x0,this._y0,this._x1,this._y1));n=u.pop();)if(!t(s=n.node,r=n.x0,o=n.y0,i=n.x1,a=n.y1)&&s.length){var l=(r+i)/2,c=(o+a)/2;(e=s[3])&&u.push(new xu(e,l,c,i,a)),(e=s[2])&&u.push(new xu(e,r,c,l,a)),(e=s[1])&&u.push(new xu(e,l,o,i,c)),(e=s[0])&&u.push(new xu(e,r,o,l,c))}return this},ku=function(t){var n,e=[],r=[];for(this._root&&e.push(new xu(this._root,this._x0,this._y0,this._x1,this._y1));n=e.pop();){
+var o=n.node;if(o.length){var i,a=n.x0,u=n.y0,s=n.x1,l=n.y1,c=(a+s)/2,h=(u+l)/2;(i=o[0])&&e.push(new xu(i,a,u,c,h)),(i=o[1])&&e.push(new xu(i,c,u,s,h)),(i=o[2])&&e.push(new xu(i,a,h,c,l)),(i=o[3])&&e.push(new xu(i,c,h,s,l))}r.push(n)}for(;n=r.pop();)t(n.node,n.x0,n.y0,n.x1,n.y1);return this},zu=function(t){return arguments.length?(this._x=t,this):this._x},Su=function(t){return arguments.length?(this._y=t,this):this._y},Cu=qn.prototype=In.prototype;Cu.copy=function(){var t,n,e=new In(this._x,this._y,this._x0,this._y0,this._x1,this._y1),r=this._root;if(!r)return e;if(!r.length)return e._root=Wn(r),e;for(t=[{source:r,target:e._root=new Array(4)}];r=t.pop();)for(var o=0;o<4;++o)(n=r.source[o])&&(n.length?t.push({source:n,target:r.target[o]=new Array(4)}):r.target[o]=Wn(n));return e},Cu.add=gu,Cu.addAll=Bn,Cu.cover=yu,Cu.data=mu,Cu.extent=vu,Cu.find=_u,Cu.remove=wu,Cu.removeAll=Hn,Cu.root=bu,Cu.size=Mu,Cu.visit=Tu,Cu.visitAfter=ku,Cu.x=zu,Cu.y=Su;var Nu,Au=function(t,n){if((e=(t=n?t.toExponential(n-1):t.toExponential()).indexOf("e"))<0)return null;var e,r=t.slice(0,e);return[r.length>1?r[0]+r.slice(2):r,+t.slice(e+1)]},ju=function(t){return t=Au(Math.abs(t)),t?t[1]:NaN},Du=function(t,n){return function(e,r){for(var o=e.length,i=[],a=0,u=t[0],s=0;o>0&&u>0&&(s+u+1>r&&(u=Math.max(1,r-s)),i.push(e.substring(o-=u,o+u)),!((s+=u+1)>r));)u=t[a=(a+1)%t.length];return i.reverse().join(n)}},Lu=function(t,n){t=t.toPrecision(n);t:for(var e,r=t.length,o=1,i=-1;o0&&(i=0)}return i>0?t.slice(0,i)+t.slice(e+1):t},Eu=function(t,n){var e=Au(t,n);if(!e)return t+"";var r=e[0],o=e[1],i=o-(Nu=3*Math.max(-8,Math.min(8,Math.floor(o/3))))+1,a=r.length;return i===a?r:i>a?r+new Array(i-a+1).join("0"):i>0?r.slice(0,i)+"."+r.slice(i):"0."+new Array(1-i).join("0")+Au(t,Math.max(0,n+i-1))[0]},Yu=function(t,n){var e=Au(t,n);if(!e)return t+"";var r=e[0],o=e[1];return o<0?"0."+new Array(-o).join("0")+r:r.length>o+1?r.slice(0,o+1)+"."+r.slice(o+1):r+new Array(o-r.length+2).join("0")},Uu={"":Lu,"%":function(t,n){return(100*t).toFixed(n)},b:function(t){return Math.round(t).toString(2)},c:function(t){return t+""},d:function(t){return Math.round(t).toString(10)},e:function(t,n){return t.toExponential(n)},f:function(t,n){return t.toFixed(n)},g:function(t,n){return t.toPrecision(n)},o:function(t){return Math.round(t).toString(8)},p:function(t,n){return Yu(100*t,n)},r:Yu,s:Eu,X:function(t){return Math.round(t).toString(16).toUpperCase()},x:function(t){return Math.round(t).toString(16)}},Xu=/^(?:(.)?([<>=^]))?([+\-\( ])?([$#])?(0)?(\d+)?(,)?(\.\d+)?([a-z%])?$/i,Fu=function(t){return new Rn(t)};Rn.prototype.toString=function(){return this.fill+this.align+this.sign+this.symbol+(this.zero?"0":"")+(null==this.width?"":Math.max(1,0|this.width))+(this.comma?",":"")+(null==this.precision?"":"."+Math.max(0,0|this.precision))+this.type};var Ou,Bu,Hu,Pu=["y","z","a","f","p","n","µ","m","","k","M","G","T","P","E","Z","Y"],Zu=function(t){function n(t){function n(t){var n,o,s,v=p,x=g;if("c"===d)x=y(t)+x,t="";else{t=+t;var _=(t<0||1/t<0)&&(t*=-1,!0);if(t=y(t,f),_)for(n=-1,o=t.length,_=!1;++ns||s>57){x=(46===s?i+t.slice(n+1):t.slice(n))+x,t=t.slice(0,n);break}}h&&!l&&(t=r(t,1/0));var w=v.length+t.length+x.length,b=w>1)+v+t+x+b.slice(w)}return b+v+t+x}t=Fu(t);var e=t.fill,a=t.align,u=t.sign,s=t.symbol,l=t.zero,c=t.width,h=t.comma,f=t.precision,d=t.type,p="$"===s?o[0]:"#"===s&&/[boxX]/.test(d)?"0"+d.toLowerCase():"",g="$"===s?o[1]:/[%p]/.test(d)?"%":"",y=Uu[d],m=!d||/[defgprs%]/.test(d);return f=null==f?d?6:12:/[gprs]/.test(d)?Math.max(1,Math.min(21,f)):Math.max(0,Math.min(20,f)),n.toString=function(){return t+""},n}function e(t,e){var r=n((t=Fu(t),t.type="f",t)),o=3*Math.max(-8,Math.min(8,Math.floor(ju(e)/3))),i=Math.pow(10,-o),a=Pu[8+o/3];return function(t){return r(i*t)+a}}var r=t.grouping&&t.thousands?Du(t.grouping,t.thousands):Gn,o=t.currency,i=t.decimal;return{format:n,formatPrefix:e}};Vn({decimal:".",thousands:",",grouping:[3],currency:["$",""]});var qu=function(t){return Math.max(0,-ju(Math.abs(t)))},Iu=function(t,n){return Math.max(0,3*Math.max(-8,Math.min(8,Math.floor(ju(n)/3)))-ju(Math.abs(t)))},Wu=function(t,n){return t=Math.abs(t),n=Math.abs(n)-t,Math.max(0,ju(n)-ju(t))+1},Ru=function(){return new $n};$n.prototype={constructor:$n,reset:function(){this.s=this.t=0},add:function(t){Jn(Gu,t,this.t),Jn(this,Gu.s,this.s),this.s?this.t+=Gu.t:this.s=Gu.t},valueOf:function(){return this.s}};var Gu=new $n,Vu=1e-6,$u=Math.PI,Ju=$u/2,Qu=$u/4,Ku=2*$u,ts=$u/180,ns=Math.abs,es=Math.atan,rs=Math.atan2,os=Math.cos,is=Math.sin,as=Math.sqrt,us=(Ru(),Ru(),Ru(),function(){var t,n=[];return{point:function(n,e){t.push([n,e])},lineStart:function(){n.push(t=[])},lineEnd:te,rejoin:function(){n.length>1&&n.push(n.pop().concat(n.shift()))},result:function(){var e=n;return n=[],t=null,e}}}),ss=function(t,n){return ns(t[0]-n[0])=0;--i)o.point((c=l[i])[0],c[1]);else r(f.x,f.p.x,-1,o);f=f.p}f=f.o,l=f.z,d=!d}while(!f.v);o.lineEnd()}}},cs=(Ru(),Ru(),Ru(),Ru()),hs=function(t,n){var e=n[0],r=n[1],o=[is(e),-os(e),0],i=0,a=0;cs.reset();for(var u=0,s=t.length;u=0?1:-1,T=M*b,k=T>$u,z=p*_;if(cs.add(rs(z*M*is(T),g*w+z*os(T))),i+=k?b+M*Ku:b,k^f>=e^v>=e){var S=ee(ne(h),ne(m));re(S);var C=ee(o,S);re(C);var N=(k^b>=0?-1:1)*Kn(C[2]);(r>N||r===N&&(S[0]||S[1]))&&(a+=k^b>=0?1:-1)}}return(i<-Vu||i0){for(_||(i.polygonStart(),_=!0),i.lineStart(),t=0;t1&&2&o&&a.push(a.pop().concat(a.shift())),p.push(a.filter(ae))}var d,p,g,y=n(i),m=o.invert(r[0],r[1]),v=us(),x=n(v),_=!1,w={point:a,lineStart:s,lineEnd:l,polygonStart:function(){w.point=c,w.lineStart=h,w.lineEnd=f,p=[],d=[]},polygonEnd:function(){w.point=a,w.lineStart=s,w.lineEnd=l,p=io(p);var t=hs(d,m);p.length?(_||(i.polygonStart(),_=!0),ls(p,ue,t,e,i)):t&&(_||(i.polygonStart(),_=!0),i.lineStart(),e(null,null,1,i),i.lineEnd()),_&&(i.polygonEnd(),_=!1),p=d=null},sphere:function(){i.polygonStart(),i.lineStart(),e(null,null,1,i),i.lineEnd(),i.polygonEnd()}};return w}};fs(function(){return!0},se,ce,[-$u,-Ju]);var ds=(os(30*ts),he(function(t){return as(2/(1+t))}));ds.invert=fe(function(t){return 2*Kn(t/2)});var ps=he(function(t){return(t=Qn(t))&&t/is(t)});ps.invert=fe(function(t){return t});var gs=function(t){var n,e,r,o,i=this,a=[i];do for(n=a.reverse(),a=[];i=n.pop();)if(t(i),e=i.children)for(r=0,o=e.length;r=0;--e)o.push(n[e]);return this},ms=function(t){for(var n,e,r,o=this,i=[o],a=[];o=i.pop();)if(a.push(o),n=o.children)for(e=0,r=n.length;e=0;)e+=r[o].value;n.value=e})},xs=function(t){return this.eachBefore(function(n){n.children&&n.children.sort(t)})},_s=function(t){for(var n=this,e=de(n,t),r=[n];n!==e;)n=n.parent,r.push(n);for(var o=r.length;t!==e;)r.splice(o,0,t),t=t.parent;return r},ws=function(){for(var t=this,n=[t];t=t.parent;)n.push(t);return n},bs=function(){var t=[];return this.each(function(n){t.push(n)}),t},Ms=function(){var t=[];return this.eachBefore(function(n){n.children||t.push(n)}),t},Ts=function(){var t=this,n=[];return t.each(function(e){e!==t&&n.push({source:e.parent,target:e})}),n};xe.prototype=pe.prototype={constructor:xe,each:gs,eachAfter:ms,eachBefore:ys,sum:vs,sort:xs,path:_s,ancestors:ws,descendants:bs,leaves:Ms,links:Ts,copy:ge};_e.prototype=Object.create(xe.prototype);var ks=([].slice,{}),zs=function(t,n){function r(t){var n,e=c.status;if(!e&&Se(c)||e>=200&&e<300||304===e){if(a)try{n=a.call(o,c)}catch(t){return void s.call("error",o,t)}else n=c;s.call("load",o,n)}else s.call("error",o,t)}var o,i,a,u,s=e("beforesend","progress","load","error"),l=Ln(),c=new XMLHttpRequest,h=null,f=null,d=0;if("undefined"==typeof XDomainRequest||"withCredentials"in c||!/^(http(s)?:)?\/\//.test(t)||(c=new XDomainRequest),"onload"in c?c.onload=c.onerror=c.ontimeout=r:c.onreadystatechange=function(t){c.readyState>3&&r(t)},c.onprogress=function(t){s.call("progress",o,t)},o={header:function(t,n){return t=(t+"").toLowerCase(),arguments.length<2?l.get(t):(null==n?l.remove(t):l.set(t,n+""),o)},mimeType:function(t){return arguments.length?(i=null==t?null:t+"",o):i},responseType:function(t){return arguments.length?(u=t,o):u},timeout:function(t){return arguments.length?(d=+t,o):d},user:function(t){return arguments.length<1?h:(h=null==t?null:t+"",o)},password:function(t){return arguments.length<1?f:(f=null==t?null:t+"",o)},response:function(t){return a=t,o},get:function(t,n){return o.send("GET",t,n)},post:function(t,n){return o.send("POST",t,n)},send:function(n,e,r){return c.open(n,t,!0,h,f),null==i||l.has("accept")||l.set("accept",i+",*/*"),c.setRequestHeader&&l.each(function(t,n){c.setRequestHeader(n,t)}),null!=i&&c.overrideMimeType&&c.overrideMimeType(i),null!=u&&(c.responseType=u),d>0&&(c.timeout=d),null==r&&"function"==typeof e&&(r=e,e=null),null!=r&&1===r.length&&(r=ze(r)),null!=r&&o.on("error",r).on("load",function(t){r(null,t)}),s.call("beforesend",o,c),c.send(null==e?null:e),o},abort:function(){return c.abort(),o},on:function(){var t=s.on.apply(s,arguments);return t===s?o:t}},null!=n){if("function"!=typeof n)throw new Error("invalid callback: "+n);return o.get(n)}return o},Ss=function(t,n){return function(e,r){var o=zs(e).mimeType(t).response(n);if(null!=r){if("function"!=typeof r)throw new Error("invalid callback: "+r);return o.get(r)}return o}};Ss("text/html",function(t){return document.createRange().createContextualFragment(t.responseText)});var Cs=Ss("application/json",function(t){return JSON.parse(t.responseText)});Ss("text/plain",function(t){return t.responseText}),Ss("application/xml",function(t){var n=t.responseXML;if(!n)throw new Error("parse error");return n});var Ns=function(t,n){return function(e,r,o){arguments.length<3&&(o=r,r=null);var i=zs(e).mimeType(t);return i.row=function(t){return arguments.length?i.response(Ce(n,r=t)):r},i.row(r),o?i.get(o):i}};Ns("text/csv",fu),Ns("text/tab-separated-values",pu);var As=Array.prototype,js=As.map,Ds=As.slice,Ls=function(t){return function(){return t}},Es=function(t){return+t},Ys=[0,1],Us=function(t,e,r){var o,i=t[0],a=t[t.length-1],u=n(i,a,null==e?10:e);switch(r=Fu(null==r?",f":r),r.type){case"s":var s=Math.max(Math.abs(i),Math.abs(a));return null!=r.precision||isNaN(o=Iu(u,s))||(r.precision=o),Hu(r,s);case"":case"e":case"g":case"p":case"r":null!=r.precision||isNaN(o=Wu(u,Math.max(Math.abs(i),Math.abs(a))))||(r.precision=o-("e"===r.type));break;case"f":case"%":null!=r.precision||isNaN(o=qu(u))||(r.precision=o-2*("%"===r.type))}return Bu(r)},Xs=new Date,Fs=new Date,Os=Fe(function(){},function(t,n){t.setTime(+t+n)},function(t,n){return n-t});Os.every=function(t){return t=Math.floor(t),isFinite(t)&&t>0?t>1?Fe(function(n){n.setTime(Math.floor(n/t)*t)},function(n,e){n.setTime(+n+e*t)},function(n,e){return(e-n)/t}):Os:null};var Bs=1e3,Hs=6e4,Ps=36e5,Zs=864e5,qs=6048e5,Is=(Fe(function(t){t.setTime(Math.floor(t/Bs)*Bs)},function(t,n){t.setTime(+t+n*Bs)},function(t,n){return(n-t)/Bs},function(t){return t.getUTCSeconds()}),Fe(function(t){t.setTime(Math.floor(t/Hs)*Hs)},function(t,n){t.setTime(+t+n*Hs)},function(t,n){return(n-t)/Hs},function(t){return t.getMinutes()}),Fe(function(t){var n=t.getTimezoneOffset()*Hs%Ps;n<0&&(n+=Ps),t.setTime(Math.floor((+t-n)/Ps)*Ps+n)},function(t,n){t.setTime(+t+n*Ps)},function(t,n){return(n-t)/Ps},function(t){return t.getHours()}),Fe(function(t){t.setHours(0,0,0,0)},function(t,n){t.setDate(t.getDate()+n)},function(t,n){return(n-t-(n.getTimezoneOffset()-t.getTimezoneOffset())*Hs)/Zs},function(t){return t.getDate()-1})),Ws=Oe(0),Rs=Oe(1),Gs=(Oe(2),Oe(3),Oe(4),Oe(5),Oe(6),Fe(function(t){t.setDate(1),t.setHours(0,0,0,0)},function(t,n){t.setMonth(t.getMonth()+n)},function(t,n){return n.getMonth()-t.getMonth()+12*(n.getFullYear()-t.getFullYear())},function(t){return t.getMonth()}),Fe(function(t){t.setMonth(0,1),t.setHours(0,0,0,0)},function(t,n){t.setFullYear(t.getFullYear()+n)},function(t,n){return n.getFullYear()-t.getFullYear()},function(t){return t.getFullYear()}));Gs.every=function(t){return isFinite(t=Math.floor(t))&&t>0?Fe(function(n){n.setFullYear(Math.floor(n.getFullYear()/t)*t),n.setMonth(0,1),n.setHours(0,0,0,0)},function(n,e){n.setFullYear(n.getFullYear()+e*t)}):null};var Vs=(Fe(function(t){t.setUTCSeconds(0,0)},function(t,n){t.setTime(+t+n*Hs)},function(t,n){return(n-t)/Hs},function(t){return t.getUTCMinutes()}),Fe(function(t){t.setUTCMinutes(0,0,0)},function(t,n){t.setTime(+t+n*Ps)},function(t,n){return(n-t)/Ps},function(t){return t.getUTCHours()}),Fe(function(t){t.setUTCHours(0,0,0,0)},function(t,n){t.setUTCDate(t.getUTCDate()+n)},function(t,n){return(n-t)/Zs},function(t){return t.getUTCDate()-1})),$s=Be(0),Js=Be(1),Qs=(Be(2),Be(3),Be(4),Be(5),Be(6),Fe(function(t){t.setUTCDate(1),t.setUTCHours(0,0,0,0)},function(t,n){t.setUTCMonth(t.getUTCMonth()+n)},function(t,n){return n.getUTCMonth()-t.getUTCMonth()+12*(n.getUTCFullYear()-t.getUTCFullYear())},function(t){return t.getUTCMonth()}),Fe(function(t){t.setUTCMonth(0,1),t.setUTCHours(0,0,0,0)},function(t,n){t.setUTCFullYear(t.getUTCFullYear()+n)},function(t,n){return n.getUTCFullYear()-t.getUTCFullYear()},function(t){return t.getUTCFullYear()}));Qs.every=function(t){return isFinite(t=Math.floor(t))&&t>0?Fe(function(n){n.setUTCFullYear(Math.floor(n.getUTCFullYear()/t)*t),n.setUTCMonth(0,1),n.setUTCHours(0,0,0,0)},function(n,e){n.setUTCFullYear(n.getUTCFullYear()+e*t)}):null};var Ks,tl,nl,el,rl,ol={"-":"",_:" ",0:"0"},il=/^\s*\d+/,al=/^%/,ul=/[\\\^\$\*\+\?\|\[\]\(\)\.\{\}]/g;Fr({dateTime:"%x, %X",date:"%-m/%-d/%Y",time:"%-I:%M:%S %p",periods:["AM","PM"],days:["Sunday","Monday","Tuesday","Wednesday","Thursday","Friday","Saturday"],shortDays:["Sun","Mon","Tue","Wed","Thu","Fri","Sat"],months:["January","February","March","April","May","June","July","August","September","October","November","December"],shortMonths:["Jan","Feb","Mar","Apr","May","Jun","Jul","Aug","Sep","Oct","Nov","Dec"]});var sl="%Y-%m-%dT%H:%M:%S.%LZ",ll=(Date.prototype.toISOString?Or:el(sl),+new Date("2000-01-01T00:00:00.000Z")?Br:rl(sl),function(t){return t.match(/.{6}/g).map(function(t){return"#"+t})});ll("1f77b4ff7f0e2ca02cd627289467bd8c564be377c27f7f7fbcbd2217becf"),ll("393b795254a36b6ecf9c9ede6379398ca252b5cf6bcedb9c8c6d31bd9e39e7ba52e7cb94843c39ad494ad6616be7969c7b4173a55194ce6dbdde9ed6"),ll("3182bd6baed69ecae1c6dbefe6550dfd8d3cfdae6bfdd0a231a35474c476a1d99bc7e9c0756bb19e9ac8bcbddcdadaeb636363969696bdbdbdd9d9d9"),ll("1f77b4aec7e8ff7f0effbb782ca02c98df8ad62728ff98969467bdc5b0d58c564bc49c94e377c2f7b6d27f7f7fc7c7c7bcbd22dbdb8d17becf9edae5"),ua(kt(300,.5,0),kt(-240,.5,1));ua(kt(-100,.75,.35),kt(80,1.5,.8)),ua(kt(260,.75,.35),kt(80,1.5,.8)),kt();Hr.prototype={areaStart:function(){this._line=0},areaEnd:function(){this._line=NaN},lineStart:function(){this._point=0},lineEnd:function(){(this._line||0!==this._line&&1===this._point)&&this._context.closePath(),this._line=1-this._line},point:function(t,n){switch(t=+t,n=+n,this._point){case 0:this._point=1,this._line?this._context.lineTo(t,n):this._context.moveTo(t,n);break;case 1:this._point=2;default:this._context.lineTo(t,n)}}};Wr.prototype={areaStart:function(){this._line=0},areaEnd:function(){this._line=NaN},lineStart:function(){this._x0=this._x1=this._y0=this._y1=this._t0=NaN,this._point=0},lineEnd:function(){switch(this._point){case 2:this._context.lineTo(this._x1,this._y1);break;case 3:Ir(this,this._t0,qr(this,this._t0))}(this._line||0!==this._line&&1===this._point)&&this._context.closePath(),this._line=1-this._line},point:function(t,n){var e=NaN;if(t=+t,n=+n,t!==this._x1||n!==this._y1){switch(this._point){case 0:this._point=1,this._line?this._context.lineTo(t,n):this._context.moveTo(t,n);break;case 1:this._point=2;break;case 2:this._point=3,Ir(this,qr(this,e=Zr(this,t,n)),e);break;default:Ir(this,this._t0,e=Zr(this,t,n))}this._x0=this._x1,this._x1=t,this._y0=this._y1,this._y1=n,this._t0=e}}},(Rr.prototype=Object.create(Wr.prototype)).point=function(t,n){Wr.prototype.point.call(this,n,t)},Gr.prototype={moveTo:function(t,n){this._context.moveTo(n,t)},closePath:function(){this._context.closePath()},lineTo:function(t,n){this._context.lineTo(n,t)},bezierCurveTo:function(t,n,e,r,o,i){this._context.bezierCurveTo(n,t,r,e,i,o)}};oi("body").append("link").attr("href","https://fonts.googleapis.com/css?family=Inconsolata").attr("rel","stylesheet");var cl={svg:{height:650,width:650},axis:{left:70,right:520,top:100,bottom:550,color:"white"},grid:{spacing:10,lineWidth:.5,color:"#D0D0D0",crosshairs:{opacity:.06,color:"gray",label:{font:"sans-serif",fontSize:"10px",padX:4,padY:11,duration:200}}},shadow:{dx:5,dy:5,std:8,scale:.2},legend:{left:70,right:520,top:565,bottom:590,rx:10,ry:10,padX:15,padY:5,fill:"none",stroke:"none",font:"sans-serif",fontSize:"10px",rows:2,columns:7,glyph:{width:6,height:6,textX:5,textY:3.5,content:[{idx:0,label:"Positive",group:"c4"},{idx:1,label:"Polar -OH",group:"c7"},{idx:2,label:"Hydrophobic",group:"c0"},{idx:3,label:"Cysteine",group:"c2"},{idx:7,label:"Negative",group:"c5"},{idx:8,label:"Polar -CON",group:"c6"},{idx:9,label:"Aromatic",group:"c1"}]},magnitude:{idx:4,textX:13,textY:3.5,shiftX:43,offsets:[-27,-16,-7,0,5],radii:[6,5,4,3,2]},cmap:{idx:11,leftX:-25,leftY:3.5,rightX:26,rightY:3.5,shiftX:30,height:6,width:42,blocks:7}},logo:{data:[],font:["Inconsolata","sans-serif"],height:25,fontScale:.2,bitScale:4,opacity:1,pad:2,axis:{pad:2,max:Math.log2(20),majorTicks:[0,1,2,3,4],minorTicks:[.5,1.5,2.5],majorLength:2.5,minorLength:1,textX:-6,stroke:"black",strokeWidth:.5},zoom:{height:60,lift:40,width:150,radius:5,fontScale:1.5,duration:100,destroyDuration:150,delay:0,opacity:0,easeFun:Sn,underline:{color:"gray",width:.5,pad:2.5,notchRadius:2.5,notchHeight:3,duration:300,delay:75}}},couplings:{data:[],fill:"#B8B8B8",highlight:"gray",matchColor:"white",stroke:"white",strokeWidth:.5,maxRadius:3.5},times:{globalTick:10,destroyDuration:0,buildDuration:300,matchedTimeThreshold:150},matrix:{x:335,y:650,cellSize:15,opacity:.8,gridColor:"#D0D0D0",gridWidth:.5,textUp:2,textOver:2.5,font:"Inconsolata",fontSize:"20px",background:{fill:"white",stroke:"#D0D0D0",strokeWidth:.5,padRight:19,padTop:19,padLeft:5,padBottom:5,opacity:.8},cscale:Xe().domain([-1,0,1]).range(["#3374FF","white","#FFBE33"])},state:{viewerLoaded:0,x:0,y:0,i:0,j:0,iOld:0,jOld:0,focus:-1,zoomBuilt:0,matchedTime:0,matchedBuilt:0}};cl.aaGroups={".":"gr","-":"gr",G:"c0",A:"c0",I:"c0",V:"c0",L:"c0",M:"c0",F:"c1",Y:"c1",W:"c1",H:"c4",C:"c2",P:"c3",K:"c4",R:"c4",D:"c5",E:"c5",Q:"c6",N:"c6",S:"c7",T:"c7",B:"c8",Z:"c8",X:"c8","?":"c9","*":"c8",U:"bl"},cl.groupColors={gr:"grey",bl:"black",m0:"blue",m1:"red",c0:"#33cc00",c1:"#009900",c2:"#ffff00",c3:"#33cc00",c4:"#cc0000",c5:"#0033ff",c6:"#6600cc",c7:"#0099ff",c8:"#666666",c9:"#999999"},cl.groupOrder=["c0","c1","c2","c3","c4","c5","c6","c7"],cl.plotWidth=function(){return cl.axis.right-cl.axis.left},cl.plotHeight=function(){return cl.axis.bottom-cl.axis.top},cl.iToX=function(t){return cl.axis.left+t*(cl.axis.right-cl.axis.left)/cl.logo.data.length},cl.jToY=function(t){return cl.axis.top+t*(cl.axis.bottom-cl.axis.top)/cl.logo.data.length},cl.focusLength=function(t){return t*(cl.axis.right-cl.axis.left)/cl.logo.data.length},cl.barWidth=function(){return(cl.axis.right-cl.axis.left)/cl.logo.data.length},cl.radiusFun=function(t){return cl.couplings.maxRadius*Math.sqrt(t)},cl.tick=function(){var t=cl.state.i!=cl.state.iOld||cl.state.j!=cl.state.jOld;cl.state.viewerLoaded>0&&(0!=cl.state.matchedBuilt||t?cl.state.matchedTime=0:cl.state.matchedTime+=cl.times.globalTick);var n=cl.state.matchedTime-cl.times.matchedTimeThreshold;n>0&&ncl.axis.top&&cl.state.ycl.axis.left&&cl.state.xcl.times.matchedTimeThreshold;if(cl.state.viewerLoaded>0&&(r||o&&0==cl.state.matchedBuilt)){if(e&&(0==cl.state.matchedBuilt&&o||1==cl.state.matchedBuilt&&r)){cl.state.matchedBuilt=1;for(var i=-1,a=0;a=0&&(u=Vr(cl.state.i,cl.state.j,t[cl.state.focus].i-1,t[cl.state.focus].j-1)-cl.radiusFun(t[cl.state.focus].score)),u>cl.logo.zoom.radius){ii("#legendCmap").transition().attr("opacity",0).delay(0).duration(cl.times.destroyDuration),oi("#matrixBG").transition().attr("opacity",0).delay(0).duration(cl.times.buildDuration);for(var s=0;s<20;s++)for(var l=0;l<20;l++)oi("#disp"+s+"-"+l).transition().style("opacity",0).delay(0).duration(cl.times.destroyDuration),oi("#biC"+s).transition().style("opacity",0).delay(0).duration(cl.times.destroyDuration),oi("#bjC"+l).transition().style("opacity",0).delay(0).duration(cl.times.destroyDuration);cl.state.focus=-1,cl.state.matchedBuilt=0,cl.state.matchedTime=0}if(i>=0&&i!=cl.state.focus){console.log("Zooming at "+(cl.state.i+1)+", "+(cl.state.j+1));for(var s=0;s<20;s++)for(var l=0;l<20;l++)cl.matrix.nodes.cells[s][l].transition().style("opacity",0).delay(0).duration(cl.times.destroyDuration),cl.matrix.nodes.iLabels[s].transition().style("opacity",0),cl.matrix.nodes.jLabels[l].transition().style("opacity",0);cl.state.i+1,cl.state.j+1;cl.couplings.nodes.circles[i].transition().attr("fill",cl.couplings.fill).delay(0).duration(cl.times.buildDuration);var c=cl.iToX(cl.state.i)+cl.matrix.background.padLeft,h=cl.jToY(cl.state.j)+cl.matrix.background.padTop,f=t[i].matrix.length*cl.matrix.cellSize+cl.matrix.background.padRight+cl.matrix.background.padLeft,d=t[i].matrix[0].length*cl.matrix.cellSize+cl.matrix.background.padTop+cl.matrix.background.padBottom;ii("#legendCmap").transition().attr("opacity",1).delay(cl.times.destroyDuration).duration(cl.times.buildDuration),oi("#matrixBG").attr("x",c-cl.matrix.background.padLeft).attr("y",h-cl.matrix.background.padTop).attr("width",0).attr("height",0),oi("#matrixBG").transition().attr("width",f).attr("height",d).attr("opacity",cl.matrix.background.opacity).delay(cl.times.destroyDuration).duration(cl.times.buildDuration);for(var s=0;s=cl.state.i-cl.logo.zoom.radius&&t[a].i-1<=cl.state.i+cl.logo.zoom.radius||t[a].j-1>=cl.state.j-cl.logo.zoom.radius&&t[a].j-1<=cl.state.j+cl.logo.zoom.radius)?cl.couplings.nodes.circles[a].attr("fill",cl.couplings.highlight):cl.couplings.nodes.circles[a].attr("fill",cl.couplings.fill)}if(1==cl.state.zoomBuilt&&!e){console.log("Contracting logo");for(var y=Math.max(0,cl.state.iOld-cl.logo.zoom.radius),m=Math.min(n.length-1,cl.state.iOld+cl.logo.zoom.radius),s=y;s<=m;s++)for(var b=0,l=0;lm)for(var b=0,l=0;lm)for(var b=0,l=0;ln.bits?1:0:au?1:0})}},cl.prepareCouplings=function(){cl.couplings.data.sort(function(t,n){return t.score>n.score?-1:t.scoret&&(t=cl.couplings.data[n].score);for(var n=0;ne&&(e=Math.abs(cl.couplings.data[n].matrix[r][o]));for(var n=0;nn&&(cl.state.viewerLoaded=1)},0);setInterval(cl.tick,cl.times.globalTick)},cl.initialize=function(){var t="",n=oi("#evzoom-viewer");n.empty()||(t=n.node().getAttribute("data-couplings"));for(var e="",r=/([^&=]+)=?([^&]*)/g,o=window.location.search.substring(1);e=r.exec(o);)e.length>2&&"data"==e[1]&&(t=e[2]);console.log("Loading "+t),Cs(t).on("progress",function(){null!=mo&&mo.hasAttribute("loaded")&&console.log("progress",mo.loaded)}).on("load",cl.prepareData).on("error",function(t){console.log("failure!",t)}).get()},cl.initialize()});
diff --git a/evzoom.sublime-project b/evzoom.sublime-project
new file mode 100644
index 0000000..568a013
--- /dev/null
+++ b/evzoom.sublime-project
@@ -0,0 +1,15 @@
+{
+ "folders":
+ [
+ {
+ "path": "."
+ }
+ ],
+ "build_systems":
+ [
+ {
+ "name": "Build",
+ "shell_cmd": "npm run build"
+ }
+ ]
+}
diff --git a/example/evzoom.html b/example/evzoom.html
new file mode 100755
index 0000000..c348cb0
--- /dev/null
+++ b/example/evzoom.html
@@ -0,0 +1,7 @@
+
+
+EVzoom
+
+
+
+
\ No newline at end of file
diff --git a/package.json b/package.json
new file mode 100755
index 0000000..7b6a566
--- /dev/null
+++ b/package.json
@@ -0,0 +1,29 @@
+{
+ "name": "evzoom",
+ "version": "0.1.0",
+ "description": "",
+ "main": "dist/evzoom.js",
+ "scripts": {
+ "build": "rollup -c && uglifyjs build/evzoom.dev.js -cm > dist/evzoom.js"
+ },
+ "homepage": "https://github.com/debbiemarkslab/EVzoom",
+ "repository": {
+ "type": "git",
+ "url": "https://github.com/debbiemarkslab/EVzoom.git"
+ },
+ "bugs": {
+ "url": "https://github.com/debbiemarkslab/EVzoom/issues"
+ },
+ "author": "John Ingraham ",
+ "contributors": [],
+ "license": "",
+ "keywords": [
+ "Coevolution",
+ "Undirected graphical model"
+ ],
+ "devDependencies": {
+ "d3": "^4.0.0",
+ "rollup-plugin-node-resolve": "^2.0.0"
+ },
+ "dependencies": {}
+}
\ No newline at end of file
diff --git a/rollup.config.js b/rollup.config.js
new file mode 100755
index 0000000..be90514
--- /dev/null
+++ b/rollup.config.js
@@ -0,0 +1,9 @@
+import npm from "rollup-plugin-node-resolve";
+
+export default {
+ entry: "src/evzoom.js",
+ dest: "build/evzoom.dev.js",
+ format: "umd",
+ moduleName: "d3",
+ plugins: [npm({jsnext: true})]
+};
\ No newline at end of file
diff --git a/src/README.md b/src/README.md
new file mode 100755
index 0000000..770ea94
--- /dev/null
+++ b/src/README.md
@@ -0,0 +1,17 @@
+
+# Compiling EVzoom
+Note: The following is only required for development. A compiled, ready-to-run version of EVzoom is provided at dist/evzoom.js.
+
+## Install dependencies
+EVzoom is bundled and minified with the Node.js packages `rollup` and `uglifyjs`. After installing Node, these dependencies can be globally installed with
+
+ npm install -g rollup
+ npm install -g uglify-js
+
+## Building
+To build EVzoom, run
+
+ npm install
+ npm run build
+
+This will build evzoom into dist/evzoom.js.
\ No newline at end of file
diff --git a/src/evzoom.js b/src/evzoom.js
new file mode 100755
index 0000000..b202d82
--- /dev/null
+++ b/src/evzoom.js
@@ -0,0 +1,1438 @@
+/**
+ * @file evzoom
+ * @private
+ * @author John Ingraham
+ */
+
+import * as d3 from "d3";
+
+// Utility functions
+function dist(xi, yi, xj, yj) { return Math.sqrt((xi - xj) * (xi - xj) + (yi - yj) * (yi - yj)); }
+
+// Monospace from Google Fonts for Logo text
+d3.select("body")
+ .append("link")
+ .attr("href", "https://fonts.googleapis.com/css?family=Inconsolata")
+ .attr("rel", "stylesheet")
+
+var EVzoom = {
+ svg: {
+ height: 650,
+ width: 650
+ },
+ axis: {
+ left: 70,
+ right: 520,
+ top: 100,
+ bottom: 550,
+ color: "white"
+ },
+ grid: {
+ spacing: 10,
+ lineWidth: 0.5,
+ color: "#D0D0D0",
+ crosshairs: {
+ opacity: 0.06,
+ color: "gray",
+ label: {
+ font: "sans-serif",
+ fontSize: "10px",
+ padX: 4,
+ padY: 11,
+ duration: 200
+ }
+ }
+ },
+ shadow: {
+ dx: 5,
+ dy: 5,
+ std: 8,
+ scale: 0.2
+ },
+ legend: {
+ left: 70,
+ right: 520,
+ top: 565,
+ bottom: 590,
+ rx: 10,
+ ry: 10,
+ padX: 15,
+ padY: 5,
+ fill: "none",
+ stroke: "none",
+ font: "sans-serif",
+ fontSize: "10px",
+ rows: 2,
+ columns: 7,
+ glyph: {
+ width: 6,
+ height: 6,
+ textX: 5,
+ textY: 3.5,
+ content: [
+ {idx: 0, label: "Positive", group: "c4"},
+ {idx: 1, label: "Polar -OH", group: "c7"},
+ {idx: 2, label: "Hydrophobic", group: "c0"},
+ {idx: 3, label: "Cysteine", group: "c2"},
+ {idx: 7, label: "Negative", group: "c5"},
+ {idx: 8, label: "Polar -CON", group: "c6"},
+ {idx: 9, label: "Aromatic", group: "c1"}
+ ]
+ },
+ magnitude: {
+ idx: 4,
+ textX: 13,
+ textY: 3.5,
+ shiftX: 43,
+ offsets: [-27, -16, -7, 0, 5],
+ radii: [6, 5, 4, 3, 2]
+ },
+ cmap: {
+ idx: 11,
+ leftX: -25,
+ leftY: 3.5,
+ rightX: 26,
+ rightY: 3.5,
+ shiftX: 30,
+ height: 6,
+ width: 42,
+ blocks: 7
+ }
+ },
+ logo: {
+ data: [],
+ font: ["Inconsolata", "sans-serif"],
+ height: 25,
+ fontScale: 0.2,
+ bitScale: 4,
+ opacity: 1.0,
+ pad: 2,
+ axis: {
+ pad: 2,
+ max: Math.log2(20),
+ majorTicks: [0, 1, 2, 3, 4],
+ minorTicks: [0.5, 1.5, 2.5],
+ majorLength: 2.5,
+ minorLength: 1,
+ textX: -6,
+ stroke: "black",
+ strokeWidth: 0.5
+ },
+ zoom: {
+ height: 60,
+ lift: 40,
+ width: 150,
+ radius: 5,
+ fontScale: 1.5,
+ duration: 100,
+ destroyDuration: 150,
+ delay: 0,
+ opacity: 0,
+ easeFun: d3.easeCubic,
+ underline: {
+ color: "gray",
+ width: 0.5,
+ pad: 2.5,
+ notchRadius: 2.5,
+ notchHeight: 3,
+ duration: 300,
+ delay: 75
+ }
+ }
+ },
+ couplings: {
+ data: [],
+ fill: "#B8B8B8",
+ highlight: "gray",
+ matchColor: "white",
+ stroke: "white",
+ strokeWidth: 0.5,
+ maxRadius: 3.5
+ },
+ times: {
+ globalTick: 10,
+ destroyDuration: 0,
+ buildDuration: 300,
+ matchedTimeThreshold: 150
+ },
+ matrix: {
+ x: 335,
+ y: 650,
+ cellSize: 15,
+ opacity: 0.8,
+ gridColor: "#D0D0D0",
+ gridWidth: 0.5,
+ textUp: 2,
+ textOver: 2.5,
+ font: "Inconsolata",
+ fontSize: "20px",
+ background: {
+ fill: "white",
+ stroke: "#D0D0D0",
+ strokeWidth: 0.5,
+ padRight: 19,
+ padTop: 19,
+ padLeft: 5,
+ padBottom: 5,
+ opacity: 0.8
+ },
+ cscale: d3.scaleLinear().domain([-1, 0, 1]).range(["#3374FF", "white", "#FFBE33"]) // Orange and Blue
+ // cscale: d3.scaleLinear().domain([-1, 0, 1]).range(["#018AFF", "white", "#FF7601"]) // Mandarin and Light Blue
+ // cscale: d3.scaleLinear().domain([-1, 1]).range(["black", "white"])
+ // cscale: d3.scaleLinear().domain([-1, 0, 1]).range(["#FF01A5", "white", "#01FF5B"]) // Magenta and Lime
+ // cscale: d3.scaleLinear().domain([-2, -0.8, 0, 0.8, 2]).range(["#253259", "#1F4E88", "white", "#E29C29", "#c87711"])
+ // cscale: d3.scaleLinear().domain([-2, -0.8, 0, 0.8, 2]).range(["#253259", "#1F4E88", "white", "#E261A4", "#42124B"])
+ // cscale: d3.scaleLinear().domain([-1, 0, 1]).range(["blue", "white", "orange"])
+ },
+ state: {
+ viewerLoaded: 0,
+ x: 0,
+ y: 0,
+ i: 0,
+ j: 0,
+ iOld: 0,
+ jOld: 0,
+ focus: -1,
+ zoomBuilt: 0,
+ matchedTime: 0,
+ matchedBuilt: 0
+ }
+}
+
+// Color scheme from MSAviewer.org
+EVzoom.aaGroups = { ".":"gr", "-":"gr", "G":"c0", "A":"c0", "I":"c0", "V":"c0",
+ "L":"c0", "M":"c0", "F":"c1", "Y":"c1", "W":"c1", "H":"c4",
+ "C":"c2", "P":"c3", "K":"c4", "R":"c4", "D":"c5", "E":"c5",
+ "Q":"c6", "N":"c6", "S":"c7", "T":"c7", "B":"c8", "Z":"c8",
+ "X":"c8", "?":"c9", "*":"c8", "U":"bl"};
+EVzoom.groupColors = { gr:"grey", bl:"black", m0:"blue", m1:"red", c0:"#33cc00",
+ c1:"#009900", c2:"#ffff00", c3:"#33cc00", c4:"#cc0000",
+ c5:"#0033ff", c6:"#6600cc", c7:"#0099ff", c8:"#666666",
+ c9:"#999999"};
+EVzoom.groupOrder = ["c0", "c1", "c2", "c3", "c4", "c5", "c6", "c7"];
+
+// Functions for the coordinate system
+EVzoom.plotWidth = function() { return EVzoom.axis.right - EVzoom.axis.left; };
+EVzoom.plotHeight = function() { return EVzoom.axis.bottom - EVzoom.axis.top; };
+EVzoom.iToX = function(i) { return EVzoom.axis.left + i * (EVzoom.axis.right - EVzoom.axis.left) / EVzoom.logo.data.length; };
+EVzoom.jToY = function(j) { return EVzoom.axis.top + j * (EVzoom.axis.bottom - EVzoom.axis.top) / EVzoom.logo.data.length; };
+EVzoom.focusLength = function(d) { return d * (EVzoom.axis.right - EVzoom.axis.left) / EVzoom.logo.data.length; };
+EVzoom.barWidth = function() { return (EVzoom.axis.right - EVzoom.axis.left) / EVzoom.logo.data.length; };
+EVzoom.radiusFun = function(r) { return EVzoom.couplings.maxRadius * Math.sqrt(r);}
+
+EVzoom.tick = function() {
+ // Timer for counting things
+ var coordsChanged = ((EVzoom.state.i != EVzoom.state.iOld) || (EVzoom.state.j != EVzoom.state.jOld));
+ if (EVzoom.state.viewerLoaded > 0) {
+ if (EVzoom.state.matchedBuilt == 0 && !coordsChanged) {
+ EVzoom.state.matchedTime += EVzoom.times.globalTick;
+ } else {
+ EVzoom.state.matchedTime = 0;
+ }
+ }
+
+ var matchedDelay = EVzoom.state.matchedTime - EVzoom.times.matchedTimeThreshold;
+ if (matchedDelay > 0 && matchedDelay < EVzoom.times.globalTick) EVzoom.update();
+}
+
+EVzoom.update = function() {
+ var couplings = EVzoom.couplings.data;
+ var logo = EVzoom.logo.data;
+
+ // State changes since last tick
+ var onPlot = EVzoom.state.y > EVzoom.axis.top && EVzoom.state.y < EVzoom.axis.bottom
+ && EVzoom.state.x > EVzoom.axis.left && EVzoom.state.x < EVzoom.axis.right;
+ var coordsChanged = ((EVzoom.state.i != EVzoom.state.iOld) || (EVzoom.state.j != EVzoom.state.jOld));
+ var delayOver = EVzoom.state.matchedTime > EVzoom.times.matchedTimeThreshold;
+
+ if (EVzoom.state.viewerLoaded > 0 && (coordsChanged || (delayOver && EVzoom.state.matchedBuilt == 0))) {
+ // Matrix drawing
+ if (onPlot && (((EVzoom.state.matchedBuilt == 0) && delayOver)
+ || ((EVzoom.state.matchedBuilt == 1) && coordsChanged))) {
+ EVzoom.state.matchedBuilt = 1;
+ // Test if currently focused on contact
+ var match = -1;
+ for (var c = 0; c < couplings.length; c++) {
+ if ((couplings[c].i - 1 == EVzoom.state.i) && (couplings[c].j - 1 == EVzoom.state.j)) match = c;
+ }
+
+ // Destroy if we find something new or we get too far
+ var focusDist = 0;
+ if (EVzoom.state.focus >= 0) {
+ focusDist = dist(EVzoom.state.i, EVzoom.state.j, couplings[EVzoom.state.focus].i - 1, couplings[EVzoom.state.focus].j - 1)
+ - EVzoom.radiusFun(couplings[EVzoom.state.focus].score);
+ }
+ if (focusDist > EVzoom.logo.zoom.radius) {
+ d3.selectAll("#legendCmap")
+ .transition()
+ .attr("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.destroyDuration);
+ d3.select("#matrixBG")
+ .transition()
+ .attr("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.buildDuration);
+ for (var i = 0; i < 20; i++) {
+ for (var j = 0; j < 20; j++) {
+ d3.select("#" + "disp" + i + "-" + j)
+ .transition()
+ .style("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.destroyDuration);
+ d3.select("#" + "biC" + i)
+ .transition()
+ .style("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.destroyDuration);
+ d3.select("#" + "bjC" + j)
+ .transition()
+ .style("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.destroyDuration);
+ }
+ }
+ EVzoom.state.focus = -1;
+ EVzoom.state.matchedBuilt = 0;
+ EVzoom.state.matchedTime = 0;
+ }
+
+ //======================== Begin Display Widget ==========================\
+ // Expand matrix at new match
+ if ((match >= 0) && (match != EVzoom.state.focus)) {
+ console.log("Zooming at " + (EVzoom.state.i + 1) + ", " + (EVzoom.state.j + 1))
+ // Destroy old
+ for (var i = 0; i < 20; i++) {
+ for (var j = 0; j < 20; j++) {
+ EVzoom.matrix.nodes.cells[i][j]
+ .transition()
+ .style("opacity", 0)
+ .delay(0)
+ .duration(EVzoom.times.destroyDuration);
+ EVzoom.matrix.nodes.iLabels[i]
+ .transition()
+ .style("opacity", 0);
+ EVzoom.matrix.nodes.jLabels[j]
+ .transition()
+ .style("opacity", 0);
+ }
+ }
+ // Build new
+ var ix = EVzoom.state.i + 1;
+ var jx = EVzoom.state.j + 1;
+ EVzoom.couplings.nodes.circles[match]
+ .transition()
+ .attr("fill", EVzoom.couplings.fill)
+ .delay(0)
+ .duration(EVzoom.times.buildDuration);
+
+ // Move display widget
+ var subX = EVzoom.iToX(EVzoom.state.i) + EVzoom.matrix.background.padLeft;
+ var subY = EVzoom.jToY(EVzoom.state.j) + EVzoom.matrix.background.padTop;
+ var matWidth = couplings[match].matrix.length * EVzoom.matrix.cellSize
+ + EVzoom.matrix.background.padRight + EVzoom.matrix.background.padLeft;
+ var matHeight = couplings[match].matrix[0].length * EVzoom.matrix.cellSize
+ + EVzoom.matrix.background.padTop + EVzoom.matrix.background.padBottom;
+ // Background
+ d3.selectAll("#legendCmap")
+ .transition()
+ .attr("opacity", 1)
+ .delay(EVzoom.times.destroyDuration)
+ .duration(EVzoom.times.buildDuration);
+ d3.select("#matrixBG")
+ .attr("x", subX - EVzoom.matrix.background.padLeft)
+ .attr("y", subY - EVzoom.matrix.background.padTop)
+ .attr("width", 0)
+ .attr("height", 0);
+ d3.select("#matrixBG")
+ .transition()
+ .attr("width", matWidth)
+ .attr("height", matHeight)
+ .attr("opacity", EVzoom.matrix.background.opacity)
+ .delay(EVzoom.times.destroyDuration)
+ .duration(EVzoom.times.buildDuration);
+ // Matrix
+ for (var i = 0; i < couplings[match].matrix.length; i++) {
+ for (var j = 0; j < couplings[match].matrix[i].length; j++) {
+ EVzoom.matrix.nodes.cells[i][j]
+ .style("opacity", 0)
+ .attr("x", subX)
+ .attr("y", subY)
+ .attr("width", 0)
+ .attr("height", 0);
+ EVzoom.matrix.nodes.cells[i][j]
+ .transition()
+ .style("opacity", EVzoom.matrix.opacity)
+ .style("stroke", EVzoom.matrix.gridColor)
+ .style("stroke-width", EVzoom.matrix.gridWidth)
+ .style("fill", EVzoom.matrix.cscale(couplings[match].matrix[i][j]))
+ .attr("x", subX + i * EVzoom.matrix.cellSize)
+ .attr("y", subY + j * EVzoom.matrix.cellSize)
+ .attr("width", EVzoom.matrix.cellSize)
+ .attr("height", EVzoom.matrix.cellSize)
+ .delay(EVzoom.times.destroyDuration)
+ .duration(EVzoom.times.buildDuration);
+ // Text move
+ var xshift = subX + i * EVzoom.matrix.cellSize + EVzoom.matrix.textOver;
+ var yshift = subY - EVzoom.matrix.textUp;
+ EVzoom.matrix.nodes.iLabels[i]
+ .attr("transform", "translate(" + xshift + "," + yshift + ")")
+ .text(couplings[match].iC[i])
+ .transition()
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[couplings[match].iC[i]]])
+ .style("opacity", 1)
+ .delay(EVzoom.times.destroyDuration)
+ .duration(EVzoom.times.buildDuration);
+ xshift = subX + couplings[match].matrix.length * EVzoom.matrix.cellSize + EVzoom.matrix.textUp;
+ yshift = subY + j * EVzoom.matrix.cellSize + EVzoom.matrix.textOver;
+ EVzoom.matrix.nodes.jLabels[j]
+ .text(couplings[match].jC[j])
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90)")
+ .transition()
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[couplings[match].jC[j]]])
+ .style("opacity", 1)
+ .delay(EVzoom.times.destroyDuration)
+ .duration(EVzoom.times.buildDuration);
+ }
+ }
+ EVzoom.state.focus = match;
+ }
+ }
+ //========================= End Display Widget ===========================
+
+
+ if (coordsChanged) {
+ console.log("Moving focus window")
+ // Move the crosshairs if on the grid
+ if ((EVzoom.state.zoomBuilt == 1) && onPlot) {
+ var starti = Math.max(0, EVzoom.state.i - EVzoom.logo.zoom.radius);
+ var stopi = Math.min(logo.length - 1, EVzoom.state.i + EVzoom.logo.zoom.radius);
+ var startj = Math.max(0, EVzoom.state.j - EVzoom.logo.zoom.radius);
+ var stopj = Math.min(logo.length - 1, EVzoom.state.j + EVzoom.logo.zoom.radius);
+ d3.select("#wVert")
+ .attr("x", EVzoom.iToX(starti))
+ .attr("width", EVzoom.jToY(stopi) - EVzoom.jToY(starti))
+ .attr("opacity", EVzoom.grid.crosshairs.opacity);
+ d3.select("#wHoriz")
+ .attr("y", EVzoom.jToY(startj))
+ .attr("height", EVzoom.jToY(stopj) - EVzoom.jToY(startj))
+ .attr("opacity", EVzoom.grid.crosshairs.opacity);
+ // Label the vertical axis (horizontal crosshair)
+ var jString = EVzoom.map.indices[EVzoom.state.j].toString();
+ if (EVzoom.map.letters[EVzoom.state.j] != "-") {
+ jString += " " + EVzoom.map.letters[EVzoom.state.j].toString();
+ }
+ d3.select("#vZoomIndex")
+ .attr("x", EVzoom.axis.left - EVzoom.grid.crosshairs.label.padX)
+ .attr("y", EVzoom.jToY(EVzoom.state.j))
+ .attr("opacity", 1)
+ .text(jString);
+ // Label the horizontal axis (vertical crosshair)
+ var iString = EVzoom.map.indices[EVzoom.state.i].toString();
+ if (EVzoom.map.letters[EVzoom.state.i] != "-") {
+ iString += " " + EVzoom.map.letters[EVzoom.state.i].toString();
+ }
+ d3.select("#hZoomIndex")
+ .attr("x", EVzoom.iToX(EVzoom.state.i))
+ .attr("y", EVzoom.axis.bottom + EVzoom.grid.crosshairs.label.padY)
+ .attr("opacity", 1)
+ .text(iString);
+ } else {
+ // Hide if off
+ d3.select("#wVert")
+ .attr("opacity", 0);
+ d3.select("#wHoriz")
+ .attr("opacity", 0);
+ d3.select("#vZoomIndex")
+ .transition()
+ .attr("opacity", 0)
+ .duration(EVzoom.grid.crosshairs.label.duration)
+ .delay(0);
+ d3.select("#hZoomIndex")
+ .transition()
+ .attr("opacity", 0)
+ .duration(EVzoom.grid.crosshairs.label.duration)
+ .delay(0);
+ }
+
+ // Highlight the relevant couplings
+ for (var c = 0; c < couplings.length; c++) {
+ if (onPlot &&
+ ((couplings[c].i - 1 >= EVzoom.state.i - EVzoom.logo.zoom.radius && couplings[c].i - 1 <= EVzoom.state.i + EVzoom.logo.zoom.radius) ||
+ (couplings[c].j - 1 >= EVzoom.state.j - EVzoom.logo.zoom.radius && couplings[c].j - 1 <= EVzoom.state.j + EVzoom.logo.zoom.radius))) {
+ EVzoom.couplings.nodes.circles[c]
+ .attr("fill", EVzoom.couplings.highlight);
+ } else {
+ EVzoom.couplings.nodes.circles[c]
+ .attr("fill", EVzoom.couplings.fill);
+ }
+ }
+ }
+
+ if ((EVzoom.state.zoomBuilt == 1) && !onPlot) {
+ console.log("Contracting logo")
+ // Contract Horizontal
+ var starti = Math.max(0, EVzoom.state.iOld - EVzoom.logo.zoom.radius);
+ var stopi = Math.min(logo.length - 1, EVzoom.state.iOld + EVzoom.logo.zoom.radius);
+ for (var i = starti; i <= stopi; i++) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var xshift = EVzoom.iToX(i);
+ var yshift = EVzoom.axis.top - EVzoom.logo.pad - cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ // Transition letters
+ EVzoom.logo.nodes.hLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(0) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.destroyDuration)
+ .delay(EVzoom.logo.zoom.delay);
+ // Transition blocks
+ EVzoom.logo.nodes.hBlocks[i][j]
+ .transition()
+ .attr("opacity", EVzoom.logo.opacity)
+ .attr("x", xshift)
+ .attr("y", yshift - blockHeight)
+ .attr("width", EVzoom.barWidth())
+ .attr("height", blockHeight)
+ .duration(EVzoom.logo.zoom.destroyDuration)
+ .delay(EVzoom.logo.zoom.delay);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ // Contract Vertical
+ starti = Math.max(0, EVzoom.state.jOld - EVzoom.logo.zoom.radius);
+ stopi = Math.min(logo.length - 1, EVzoom.state.jOld + EVzoom.logo.zoom.radius);
+ for (var i = 0; i < logo.length; i++) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var yshift = EVzoom.jToY(i);
+ var xshift = EVzoom.axis.right + EVzoom.logo.pad + cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ // Transitions
+ EVzoom.logo.nodes.vLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.destroyDuration)
+ .delay(EVzoom.logo.zoom.delay);
+ // Transition blocks
+ EVzoom.logo.nodes.vBlocks[i][j]
+ .transition()
+ .attr("x", xshift)
+ .attr("y", yshift)
+ .attr("opacity", EVzoom.logo.opacity)
+ .attr("width", blockHeight)
+ .attr("height", EVzoom.barWidth())
+ .duration(EVzoom.logo.zoom.destroyDuration)
+ .delay(EVzoom.logo.zoom.delay);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ // Destroy zoom lines
+ d3.select("#hZoomLine")
+ .transition()
+ .attr("opacity", 0)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay);
+ d3.select("#hZoomNotch")
+ .transition()
+ .attr("d", notchPath1)
+ .attr("opacity", 0)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay);
+ d3.select("#vZoomLine")
+ .transition()
+ .attr("opacity", 0)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay);
+ d3.select("#vZoomNotch")
+ .transition()
+ .attr("d", notchPath1)
+ .attr("opacity", 0)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay);
+ EVzoom.state.zoomBuilt = 0;
+ }
+
+ // Logo zooming
+ if (onPlot && coordsChanged) {
+ // Horizontal update
+ // Determine any new positions
+ var starti = Math.max(0, EVzoom.state.i - EVzoom.logo.zoom.radius);
+ var stopi = Math.min(logo.length - 1, EVzoom.state.i + EVzoom.logo.zoom.radius);
+ if (EVzoom.state.i != EVzoom.state.iOld) {
+ /// Expand focused columns
+ var zoomLetterWidth = EVzoom.logo.zoom.width / (1 + 2 * EVzoom.logo.zoom.radius);
+ var xcenter = EVzoom.iToX(EVzoom.state.i);
+ for (var i = starti; i <= stopi; i++) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var xshift = xcenter + (i - EVzoom.state.i - 0.5) * zoomLetterWidth;
+ var yshift = EVzoom.axis.top - EVzoom.logo.zoom.lift - cumulative;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.zoom.height;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale * 4;
+ // Transition letters
+ EVzoom.logo.nodes.hLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(0) scale(" + EVzoom.logo.zoom.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ // Transition blocks
+ EVzoom.logo.nodes.hBlocks[i][j]
+ .transition()
+ .attr("x", xshift)
+ .attr("y", yshift - blockHeight)
+ // .attr("opacity", 0.4 * Math.abs(i - EVzoom.state.i) / EVzoom.logo.zoom.radius * Math.abs(i - EVzoom.state.i) / EVzoom.logo.zoom.radius)
+ // .attr("opacity", 0.5 / (Math.abs(i - EVzoom.state.i)**2 + 1))
+ // .attr("opacity", (i == EVzoom.state.i ? 0 : 0))
+ .attr("opacity", EVzoom.logo.zoom.opacity)
+ .attr("width", zoomLetterWidth)
+ .attr("height", blockHeight)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ // Contract unfocused columns
+ var oldstarti = Math.max(0, EVzoom.state.iOld - EVzoom.logo.zoom.radius);
+ var oldstopi = Math.min(logo.length - 1, EVzoom.state.iOld + EVzoom.logo.zoom.radius);
+ for (var i = oldstarti; i <= oldstopi; i++) {
+ if (i < starti | i > stopi) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var xshift = EVzoom.iToX(i);
+ var yshift = EVzoom.axis.top - EVzoom.logo.pad - cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ // Transition letters
+ EVzoom.logo.nodes.hLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(0) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ // Transition blocks
+ EVzoom.logo.nodes.hBlocks[i][j]
+ .transition()
+ .attr("x", xshift)
+ .attr("y", yshift - blockHeight)
+ .attr("opacity", EVzoom.logo.opacity)
+ .attr("width", EVzoom.barWidth())
+ .attr("height", blockHeight)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ }
+ // Move the underline
+ var xleft = xcenter + (starti - EVzoom.state.i - 0.5) * zoomLetterWidth;
+ var xright = xcenter + (stopi + 1 - EVzoom.state.i - 0.5) * zoomLetterWidth;
+ var yshift = EVzoom.axis.top - EVzoom.logo.zoom.lift + EVzoom.logo.zoom.underline.pad;
+ d3.select("#hZoomLine")
+ .transition()
+ .attr("x1", xcenter)
+ .attr("x2", xcenter)
+ .attr("y1", yshift)
+ .attr("y2", yshift)
+ .attr("opacity", 1)
+ .duration(0)
+ .delay(0)
+ .transition()
+ .attr("x1", xleft)
+ .attr("x2", xright)
+ .duration(EVzoom.logo.zoom.underline.duration)
+ .delay(EVzoom.logo.zoom.underline.delay);
+ var rad = EVzoom.logo.zoom.underline.notchRadius;
+ var notchPath1 = "M" + (xcenter - rad) + "," + yshift
+ + "L" + (xcenter + rad) + "," + yshift
+ + "L" + xcenter + "," + yshift + "Z";
+ var notchPath2 = "M" + (xcenter - rad) + "," + yshift
+ + "L" + (xcenter + rad) + "," + yshift
+ + "L" + xcenter + "," + (yshift + EVzoom.logo.zoom.underline.notchHeight) + "Z";
+ d3.select("#hZoomNotch")
+ .transition()
+ .attr("d", notchPath1)
+ .attr("opacity", 1)
+ .duration(0)
+ .delay(0)
+ .transition()
+ .attr("d", notchPath2)
+ .duration(EVzoom.logo.zoom.underline.duration)
+ .delay(EVzoom.logo.zoom.underline.delay);
+ }
+
+ // Vertical update
+ // Determine any new positions
+ var starti = Math.max(0, EVzoom.state.j - EVzoom.logo.zoom.radius);
+ var stopi = Math.min(logo.length - 1, EVzoom.state.j + EVzoom.logo.zoom.radius);
+ if (EVzoom.state.j != EVzoom.state.jOld) {
+ var zoomLetterWidth = EVzoom.logo.zoom.width / (1 + 2 * EVzoom.logo.zoom.radius);
+ // Expand focused columns
+ var ycenter = EVzoom.jToY(EVzoom.state.j);
+ for (var i = starti; i <= stopi; i++) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var yshift = ycenter + (i - EVzoom.state.j - 0.5) * zoomLetterWidth;
+ var xshift = EVzoom.axis.right + EVzoom.logo.zoom.lift + cumulative;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.zoom.height;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale * 4;
+ // Transitions
+ EVzoom.logo.nodes.vLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90) scale(" + EVzoom.logo.zoom.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ // Transition blocks
+ EVzoom.logo.nodes.vBlocks[i][j]
+ .transition()
+ .attr("x", xshift)
+ .attr("y", yshift)
+ .attr("opacity", EVzoom.logo.zoom.opacity)
+ .attr("width", blockHeight)
+ .attr("height", zoomLetterWidth)
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ // Contract unfocused columns
+ var oldstarti = Math.max(0, EVzoom.state.jOld - EVzoom.logo.zoom.radius);
+ var oldstopi = Math.min(logo.length - 1, EVzoom.state.jOld + EVzoom.logo.zoom.radius);
+ for (var i = oldstarti; i <= oldstopi; i++) {
+ if (i < starti | i > stopi) {
+ var cumulative = 0;
+ for (var j = 0; j < logo[i].length; j++) {
+ var yshift = EVzoom.jToY(i);
+ var xshift = EVzoom.axis.right + EVzoom.logo.pad + cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ // Transitions
+ EVzoom.logo.nodes.vLetters[i][j]
+ .transition()
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ // Transition blocks
+ EVzoom.logo.nodes.vBlocks[i][j]
+ .transition()
+ .attr("x", xshift)
+ .attr("y", yshift)
+ .attr("opacity", EVzoom.logo.opacity)
+ .attr("width", blockHeight)
+ .attr("height", EVzoom.barWidth())
+ .duration(EVzoom.logo.zoom.duration)
+ .delay(EVzoom.logo.zoom.delay)
+ .ease(EVzoom.logo.zoom.easeFun);
+ cumulative = cumulative + blockHeight;
+ }
+ }
+ }
+ // Move the underline
+ var ytop = ycenter + (starti - EVzoom.state.j - 0.5) * zoomLetterWidth;
+ var ybottom = ycenter + (stopi + 1 - EVzoom.state.j - 0.5) * zoomLetterWidth;
+ var xshift = EVzoom.axis.right + EVzoom.logo.zoom.lift - EVzoom.logo.zoom.underline.pad;
+ // console.log([ytop, ybottom])
+ d3.select("#vZoomLine")
+ .transition()
+ .attr("x1", xshift)
+ .attr("x2", xshift)
+ .attr("y1", ycenter)
+ .attr("y2", ycenter)
+ .attr("opacity", 1)
+ .duration(0)
+ .delay(0)
+ .transition()
+ .attr("y1", ytop)
+ .attr("y2", ybottom)
+ .duration(EVzoom.logo.zoom.underline.duration)
+ .delay(EVzoom.logo.zoom.underline.delay);
+ var rad = EVzoom.logo.zoom.underline.notchRadius;
+ var notchPath1 = "M" + xshift + "," + (ycenter - rad)
+ + "L" + xshift + "," + (ycenter + rad)
+ + "L" + xshift + "," + ycenter + "Z";
+ var notchPath2 = "M" + xshift + "," + (ycenter - rad)
+ + "L" + xshift + "," + (ycenter + rad)
+ + "L" + (xshift - EVzoom.logo.zoom.underline.notchHeight) + "," + ycenter + "Z";
+ d3.select("#vZoomNotch")
+ .transition()
+ .attr("d", notchPath1)
+ .attr("opacity", 1)
+ .duration(0)
+ .delay(0)
+ .transition()
+ .attr("d", notchPath2)
+ .duration(EVzoom.logo.zoom.underline.duration)
+ .delay(EVzoom.logo.zoom.underline.delay);
+ }
+ EVzoom.state.zoomBuilt = 1;
+ }
+ }
+ // Update state
+ EVzoom.state.iOld = EVzoom.state.i;
+ EVzoom.state.jOld = EVzoom.state.j;
+} // End of EVzoom.update()
+
+EVzoom.focusIJ = function() {
+ var L = EVzoom.logo.data.length;
+ var ix = Math.floor((EVzoom.state.x - EVzoom.axis.left) / (EVzoom.axis.right - EVzoom.axis.left) * L);
+ var jx = Math.floor((EVzoom.state.y - EVzoom.axis.top) / (EVzoom.axis.bottom - EVzoom.axis.top) * L);
+ var closest = 0;
+ var best = L + 1;
+ // Find closest i,j
+ var couplings = EVzoom.couplings.data;
+ for (var c = 0; c < couplings.length; c++) {
+ var edgeDist = dist(ix, jx, couplings[c].i - 1, couplings[c].j - 1) - EVzoom.radiusFun(couplings[c].score);
+ if (edgeDist < best) {
+ best = edgeDist;
+ closest = c;
+ }
+ }
+ EVzoom.state.i = couplings[closest].i - 1;
+ EVzoom.state.j = couplings[closest].j - 1;
+ EVzoom.update();
+}
+
+EVzoom.mouseMove = function() {
+ var mouse = d3.mouse(this);
+ EVzoom.state.x = mouse[0];
+ EVzoom.state.y = mouse[1];
+ var L = EVzoom.logo.data.length;
+ var ix = Math.floor((EVzoom.state.x - EVzoom.axis.left) / (EVzoom.axis.right - EVzoom.axis.left) * L);
+ var jx = Math.floor((EVzoom.state.y - EVzoom.axis.top) / (EVzoom.axis.bottom - EVzoom.axis.top) * L);
+ EVzoom.state.i = ix;
+ EVzoom.state.j = jx;
+
+ // Snappy snapping
+ var closest = 0;
+ var best = L + 1;
+ // Find closest i,j
+ var couplings = EVzoom.couplings.data;
+ for (var c = 0; c < couplings.length; c++) {
+ var edgeDist = dist(ix, jx, couplings[c].i - 1, couplings[c].j - 1) - EVzoom.radiusFun(couplings[c].score);
+ if (edgeDist < best) {
+ best = edgeDist;
+ closest = c;
+ }
+ }
+ if (best < 0) {
+ EVzoom.state.i = couplings[closest].i - 1;
+ EVzoom.state.j = couplings[closest].j - 1;
+ }
+ // console.log([ix, jx]);
+ EVzoom.update();
+}
+
+EVzoom.buildSVG = function() {
+ var logo = EVzoom.logo.data;
+ var couplings = EVzoom.couplings.data;
+
+ // Set up canvas
+ var plot = d3.select("#evzoom-viewer")
+ .append("svg")
+ .attr("width", EVzoom.svg.width)
+ .attr("height", EVzoom.svg.height)
+ .attr("overflow", "visible")
+ .on("mousemove", EVzoom.mouseMove);
+
+ // Draw axis
+ var axis = plot.append("rect")
+ .attr("x", EVzoom.iToX(0))
+ .attr("y", EVzoom.jToY(0))
+ .attr("fill", EVzoom.axis.color)
+ .attr("stroke","white")
+ .attr("width", EVzoom.plotWidth())
+ .attr("height", EVzoom.plotHeight());
+
+ // Filter for drop shadows
+ EVzoom.shadow.filter = plot.append("defs")
+ .append("filter")
+ .attr("id", "drop-shadow")
+ .attr("x", "-50%")
+ .attr("y", "-50%")
+ .attr("width", "200%")
+ .attr("height", "200%");
+ EVzoom.shadow.filter.append("feOffset")
+ .attr("in", "SourceAlpha")
+ .attr("dx", EVzoom.shadow.dx)
+ .attr("dy", EVzoom.shadow.dy)
+ .attr("result", "offsetAlpha");
+ EVzoom.shadow.filter.append("feGaussianBlur")
+ .attr("in", "offsetAlpha")
+ .attr("stdDeviation", EVzoom.shadow.std)
+ .attr("result", "blur-out");
+ EVzoom.shadow.filter.append("feColorMatrix")
+ .attr("in", "blur-out")
+ .attr("values", "0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 " + EVzoom.shadow.scale + " 0")
+ .attr("result","shadow")
+ EVzoom.shadow.filter.append("feBlend")
+ .attr("in", "SourceGraphic")
+ .attr("in2", "shadow")
+ .attr("mode", "normal");
+
+ // Draw gridlines
+ for (var i = 0; i < EVzoom.logo.data.length; i += EVzoom.grid.spacing) {
+ // Horizontal
+ plot.append("line")
+ .attr("x1", EVzoom.axis.left)
+ .attr("y1", EVzoom.jToY(i))
+ .attr("x2", EVzoom.axis.right)
+ .attr("y2", EVzoom.jToY(i))
+ .attr("stroke", EVzoom.grid.color)
+ .attr("stroke-width", EVzoom.grid.lineWidth);
+
+ // Vertical
+ plot.append("line")
+ .attr("x1", EVzoom.iToX(i))
+ .attr("y1", EVzoom.axis.top)
+ .attr("x2", EVzoom.iToX(i))
+ .attr("y2", EVzoom.axis.bottom)
+ .attr("stroke", EVzoom.grid.color)
+ .attr("stroke-width", EVzoom.grid.lineWidth);
+ }
+ // Horizontal Bottom
+ plot.append("line")
+ .attr("x1", EVzoom.axis.left)
+ .attr("x2", EVzoom.axis.right)
+ .attr("y1", EVzoom.jToY(0) + EVzoom.plotHeight())
+ .attr("y2", EVzoom.jToY(0) + EVzoom.plotHeight())
+ .attr("stroke", EVzoom.grid.color)
+ .attr("stroke-width", EVzoom.grid.lineWidth);
+ // Vertical Right
+ plot.append("line")
+ .attr("x1", EVzoom.iToX(0) + EVzoom.plotWidth())
+ .attr("x2", EVzoom.iToX(0) + EVzoom.plotWidth())
+ .attr("y1", EVzoom.axis.top)
+ .attr("y2", EVzoom.axis.bottom)
+ .attr("stroke", EVzoom.grid.color)
+ .attr("stroke-width", EVzoom.grid.lineWidth);
+ // Draw crosshairs
+ plot.append("rect")
+ .attr("id","wVert")
+ .attr("x", EVzoom.iToX(0))
+ .attr("y", EVzoom.jToY(0))
+ .attr("width", EVzoom.focusLength(2 * EVzoom.logo.zoom.radius + 1))
+ .attr("height", EVzoom.plotHeight())
+ .attr("opacity", 0)
+ .attr("fill", EVzoom.grid.crosshairs.color)
+ .attr("stroke","none");
+ plot.append("rect")
+ .attr("id","wHoriz")
+ .attr("x", EVzoom.iToX(0))
+ .attr("y", EVzoom.jToY(0))
+ .attr("width", EVzoom.plotWidth())
+ .attr("height", EVzoom.focusLength(2 * EVzoom.logo.zoom.radius + 1))
+ .attr("opacity", 0)
+ .attr("fill", EVzoom.grid.crosshairs.color)
+ .attr("stroke", "none");
+ // Text
+ var labelX = 0;
+ var labelY = 0;
+ plot.append("text")
+ .attr("id", "vZoomIndex")
+ .attr("font-family", EVzoom.grid.crosshairs.label.font)
+ .attr("font-size", EVzoom.grid.crosshairs.label.fontSize)
+ .attr("opacity", 0)
+ .attr("text-anchor", "end")
+ .attr("x", labelX)
+ .attr("y", labelY)
+ .text("0");
+ plot.append("text")
+ .attr("id", "hZoomIndex")
+ .attr("font-family", EVzoom.grid.crosshairs.label.font)
+ .attr("font-size", EVzoom.grid.crosshairs.label.fontSize)
+ .attr("opacity", 0)
+ .attr("text-anchor", "middle")
+ .attr("x", labelX)
+ .attr("y", labelY)
+ .text("0");
+
+ // Draw couplings
+ EVzoom.couplings.nodes = {};
+ EVzoom.couplings.nodes.circles = [];
+ EVzoom.couplings.maxRadius = 1.7 * EVzoom.focusLength(1);
+ console.log(EVzoom.focusLength(1))
+ for (var c = 0; c < couplings.length; c++) {
+ var node = plot.append("circle")
+ .attr("id", "c" + couplings[c].i + "-" + couplings[c].j)
+ .attr("cx", EVzoom.iToX(couplings[c].i - 1))
+ .attr("cy", EVzoom.jToY(couplings[c].j - 1))
+ .attr("fill", EVzoom.couplings.fill)
+ .attr("stroke", EVzoom.couplings.stroke)
+ .attr("stroke-width", EVzoom.couplings.strokeWidth)
+ .attr("r", 0)
+ .on("mouseover", EVzoom.focusIJ());
+ EVzoom.couplings.nodes.circles.push(node);
+ }
+
+ // Logo Lines
+ plot.append("line")
+ .attr("id", "hZoomLine")
+ .attr("x1", EVzoom.iToX(0))
+ .attr("x2", EVzoom.iToX(0))
+ .attr("y1", EVzoom.jToY(0))
+ .attr("y2", EVzoom.jToY(0))
+ .attr("stroke", EVzoom.logo.zoom.underline.color)
+ .attr("stroke-width", EVzoom.logo.zoom.underline.width)
+ .attr("opacity", 0);
+ plot.append("path")
+ .attr("id", "hZoomNotch")
+ .attr("d", "M0,0L0,0L0,0Z")
+ .attr("fill", EVzoom.logo.zoom.underline.color)
+ .attr("stroke", EVzoom.logo.zoom.underline.color)
+ .attr("stroke-width", EVzoom.logo.zoom.underline.width)
+ .attr("opacity", 0);
+ plot.append("line")
+ .attr("id", "vZoomLine")
+ .attr("x1", EVzoom.iToX(0))
+ .attr("x2", EVzoom.iToX(0))
+ .attr("y1", EVzoom.jToY(0))
+ .attr("y2", EVzoom.jToY(0))
+ .attr("stroke", EVzoom.logo.zoom.underline.color)
+ .attr("stroke-width", EVzoom.logo.zoom.underline.width)
+ .attr("opacity", 0);
+ plot.append("path")
+ .attr("id", "vZoomNotch")
+ .attr("d", "M0,0L0,0L0,0Z")
+ .attr("fill", EVzoom.logo.zoom.underline.color)
+ .attr("stroke", EVzoom.logo.zoom.underline.color)
+ .attr("stroke-width", EVzoom.logo.zoom.underline.width)
+ .attr("opacity", 0);
+
+ // Horizontal logo axis
+ var bitsToHeight = function(bits) {return EVzoom.logo.height * bits / EVzoom.logo.bitScale;}
+ plot.append("line")
+ .attr("x1", EVzoom.axis.left - EVzoom.logo.axis.pad)
+ .attr("x2", EVzoom.axis.left - EVzoom.logo.axis.pad)
+ .attr("y1", EVzoom.axis.top - EVzoom.logo.pad)
+ .attr("y2", EVzoom.axis.top - EVzoom.logo.pad - bitsToHeight(EVzoom.logo.axis.max))
+ .attr("stroke", EVzoom.logo.axis.stroke)
+ .attr("stroke-width", EVzoom.logo.axis.strokeWidth);
+ for (var i = 0; i < EVzoom.logo.axis.majorTicks.length; i++) {
+ var tickY = EVzoom.axis.top - EVzoom.logo.pad - bitsToHeight(EVzoom.logo.axis.majorTicks[i]);
+ plot.append("line")
+ .attr("x1", EVzoom.axis.left - EVzoom.logo.axis.pad)
+ .attr("x2", EVzoom.axis.left - EVzoom.logo.axis.pad - EVzoom.logo.axis.majorLength)
+ .attr("y1", tickY)
+ .attr("y2", tickY)
+ .attr("stroke", EVzoom.logo.axis.stroke)
+ .attr("stroke-width", EVzoom.logo.axis.strokeWidth);
+ }
+ var labelX = EVzoom.axis.left - EVzoom.logo.axis.pad + EVzoom.logo.axis.textX;
+ var labelY = EVzoom.axis.top - EVzoom.logo.pad;
+ plot.append("text")
+ .attr("id", "bitLabel")
+ .attr("font-family", EVzoom.legend.font)
+ .attr("font-size", EVzoom.legend.fontSize)
+ .attr("opacity", 1)
+ .attr("transform", "translate(" + labelX + "," + labelY + ") rotate(-90)")
+ .text("Bits");
+
+ // Logo building
+ EVzoom.logo.nodes = {};
+ // Draw horizontal logo
+ EVzoom.logo.nodes.hLetters = [];
+ for (var i = 0; i < logo.length; i++) {
+ var cumulative = 0;
+ EVzoom.logo.nodes.hLetters.push([]);
+ for (var j = 0; j < logo[i].length; j++) {
+ var xshift = EVzoom.iToX(i);
+ var yshift = EVzoom.axis.top - EVzoom.logo.pad - cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ var node = plot.append("text")
+ .attr("id", "hL" + logo[i][j].code + i)
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[logo[i][j].code]])
+ .style("font-size", "20px")
+ .style("font-family", EVzoom.logo.font)
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(0) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .text(logo[i][j].code);
+ cumulative = cumulative + blockHeight;
+ EVzoom.logo.nodes.hLetters[i].push(node);
+ }
+ }
+
+ // Draw horizontal blocks
+ EVzoom.logo.nodes.hBlocks = [];
+ for (var i = 0; i < logo.length; i++) {
+ var cumulative = 0;
+ EVzoom.logo.nodes.hBlocks.push([]);
+ for (var j = 0; j < logo[i].length; j++) {
+ var xshift = EVzoom.iToX(i);
+ var yshift = EVzoom.axis.top - EVzoom.logo.pad - cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ var node = plot.append("rect")
+ .attr("id", "hB" + logo[i][j].code + i)
+ .style("stroke", "none")
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[logo[i][j].code]])
+ .attr("opacity", EVzoom.logo.opacity)
+ .attr("x", xshift)
+ .attr("y", yshift - blockHeight)
+ .attr("width", EVzoom.barWidth())
+ .attr("height", blockHeight);
+ cumulative = cumulative + blockHeight;
+ EVzoom.logo.nodes.hBlocks[i].push(node);
+ }
+ }
+
+ // Draw vertical logo
+ EVzoom.logo.nodes.vLetters = [];
+ for (var i = 0; i < logo.length; i++) {
+ var cumulative = 0;
+ EVzoom.logo.nodes.vLetters.push([]);
+ for (var j = 0; j < logo[i].length; j++) {
+ var yshift = EVzoom.jToY(i);
+ var xshift = EVzoom.axis.right + EVzoom.logo.pad + cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ var node = plot.append("text")
+ .attr("id", "vL" + logo[i][j].code + i)
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[logo[i][j].code]])
+ .style("font-size", "20px")
+ .style("font-family", EVzoom.logo.font)
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90) scale(" + EVzoom.logo.fontScale + "," + scale + ")")
+ .text(logo[i][j].code);
+ cumulative = cumulative + blockHeight;
+ EVzoom.logo.nodes.vLetters[i].push(node);
+ }
+ }
+ // Draw vertical blocks
+ EVzoom.logo.nodes.vBlocks = [];
+ for (var i = 0; i < logo.length; i++) {
+ var cumulative = 0;
+ EVzoom.logo.nodes.vBlocks.push([]);
+ for (var j = 0; j < logo[i].length; j++) {
+ var yshift = EVzoom.jToY(i);
+ var xshift = EVzoom.axis.right + EVzoom.logo.pad + cumulative;
+ var scale = logo[i][j].bits / EVzoom.logo.bitScale;
+ var blockHeight = (logo[i][j].bits / EVzoom.logo.bitScale) * EVzoom.logo.height;
+ var node = plot.append("rect")
+ .attr("id", "vB" + logo[i][j].code + i)
+ .style("stroke", "none")
+ .style("fill", EVzoom.groupColors[EVzoom.aaGroups[logo[i][j].code]])
+ .attr("x", xshift)
+ .attr("y", yshift)
+ .attr("width", blockHeight)
+ .attr("height", EVzoom.barWidth());
+ cumulative = cumulative + blockHeight;
+ EVzoom.logo.nodes.vBlocks[i].push(node);
+ }
+ }
+
+ // Draw Legend
+ plot.append("rect")
+ .attr("id", "legend")
+ .attr("x", EVzoom.legend.left)
+ .attr("y", EVzoom.legend.top)
+ .attr("width", EVzoom.legend.right - EVzoom.legend.left)
+ .attr("height", EVzoom.legend.bottom - EVzoom.legend.top)
+ .attr("rx", EVzoom.legend.rx)
+ .attr("ry", EVzoom.legend.ry)
+ .style("stroke", EVzoom.legend.stroke)
+ .style("fill", EVzoom.legend.fill);
+
+ var gridX = function(idx) {
+ return EVzoom.legend.left + EVzoom.legend.padX
+ + (EVzoom.legend.right - EVzoom.legend.left - 2 * EVzoom.legend.padX)
+ * (idx % EVzoom.legend.columns) / (EVzoom.legend.columns - 1);
+ }
+ var gridY = function(idx) {
+ return EVzoom.legend.top + EVzoom.legend.padY
+ + (EVzoom.legend.bottom - EVzoom.legend.top - 2 * EVzoom.legend.padY)
+ * Math.floor(idx / EVzoom.legend.columns) / (EVzoom.legend.rows - 1);
+ }
+
+ for (var i = 0; i < EVzoom.legend.glyph.content.length; i++) {
+ // Glyph
+ plot.append("rect")
+ .attr("id", "legendBox" + i)
+ .style("stroke", "none")
+ .style("fill", EVzoom.groupColors[EVzoom.legend.glyph.content[i].group])
+ .attr("x", gridX(EVzoom.legend.glyph.content[i].idx) - EVzoom.legend.glyph.width / 2)
+ .attr("y", gridY(EVzoom.legend.glyph.content[i].idx) - EVzoom.legend.glyph.height / 2)
+ .attr("width", EVzoom.legend.glyph.width)
+ .attr("height", EVzoom.legend.glyph.height);
+ // Text
+ plot.append("text")
+ .attr("id", "legendText" + i)
+ .attr("x", gridX(EVzoom.legend.glyph.content[i].idx) + EVzoom.legend.glyph.textX)
+ .attr("y", gridY(EVzoom.legend.glyph.content[i].idx) + EVzoom.legend.glyph.textY)
+ .attr("font-family", EVzoom.legend.font)
+ .attr("font-size", EVzoom.legend.fontSize)
+ .text(EVzoom.legend.glyph.content[i].label);
+ }
+ // Couplings magnitude legend
+ var magX = gridX(EVzoom.legend.magnitude.idx) + EVzoom.legend.magnitude.shiftX;
+ var magY = gridY(EVzoom.legend.magnitude.idx);
+ for (var i = 0; i < EVzoom.legend.magnitude.radii.length; i++) {
+ // - EVzoom.legend.magnitude.spread * (i/(EVzoom.legend.magnitude.radii.length - 1) - 0.5);
+ // EVzoom.legend.magnitude.radii[i]
+ plot.append("circle")
+ .attr("id", "legendMagnitudeC" + i)
+ .attr("cx", magX + EVzoom.legend.magnitude.offsets[i])
+ .attr("cy", magY)
+ .attr("fill", EVzoom.couplings.fill)
+ .attr("stroke", EVzoom.couplings.stroke)
+ .attr("r", EVzoom.legend.magnitude.radii[i]);
+ }
+ plot.append("text")
+ .attr("id", "legendMagnitude")
+ .attr("x", magX + EVzoom.legend.magnitude.textX)
+ .attr("y", magY + EVzoom.legend.magnitude.textY)
+ .attr("font-family", EVzoom.legend.font)
+ .attr("font-size", EVzoom.legend.fontSize)
+ .text("Coupling magnitude");
+
+ // Couplings colormap legend
+ var cmapX = gridX(EVzoom.legend.cmap.idx) + EVzoom.legend.cmap.shiftX;
+ var cmapY = gridY(EVzoom.legend.cmap.idx);
+ for (var i = 0; i < EVzoom.legend.cmap.blocks; i++) {
+ var colorIndex = 2 * i / (EVzoom.legend.cmap.blocks - 1) - 1;
+ var blockOffset = (i / (EVzoom.legend.cmap.blocks) - 0.5) * EVzoom.legend.cmap.width;
+ var blockWidth = EVzoom.legend.cmap.width / EVzoom.legend.cmap.blocks;
+ plot.append("rect")
+ .attr("id", "legendCmap")
+ .style("stroke", "none")
+ .style("fill", EVzoom.matrix.cscale(colorIndex))
+ .attr("x", cmapX + blockOffset)
+ .attr("y", cmapY - EVzoom.legend.cmap.height / 2)
+ .attr("width", blockWidth)
+ .attr("height", EVzoom.legend.cmap.height)
+ .attr("opacity", 0);
+ }
+ plot.append("text")
+ .attr("id", "legendCmap")
+ .attr("x", cmapX + EVzoom.legend.cmap.rightX)
+ .attr("y", cmapY + EVzoom.legend.cmap.rightY)
+ .attr("font-family", EVzoom.legend.font)
+ .attr("font-size", EVzoom.legend.fontSize)
+ .attr("opacity", 0)
+ .text("Coupling value");
+
+ // Draw Display widget
+ EVzoom.matrix.nodes = {};
+ plot.append("rect")
+ .attr("id", "matrixBG")
+ .attr("stroke", EVzoom.matrix.background.stroke)
+ .attr("fill", EVzoom.matrix.background.fill)
+ .attr("stroke-width", EVzoom.matrix.background.strokeWidth)
+ .attr("opacity", 0)
+ .attr("x", EVzoom.axis.left)
+ .attr("y", EVzoom.axis.top)
+ .attr("width", 0)
+ .attr("height", 0)
+ .attr("filter", "url(#drop-shadow)");
+ EVzoom.matrix.nodes.cells = [];
+ for (var i = 0; i < 20; i++) {
+ EVzoom.matrix.nodes.cells.push([]);
+ for (var j = 0; j < 20; j++) {
+ var node = plot.append("rect")
+ .attr("id", "disp" + i + "-" + j)
+ .style("stroke", "none")
+ .style("stroke-width", EVzoom.matrix.gridWidth)
+ .style("fill", "gray")
+ .style("opacity", 0)
+ .attr("x", EVzoom.matrix.x + i * EVzoom.matrix.cellSize)
+ .attr("y", EVzoom.matrix.y + j * EVzoom.matrix.cellSize)
+ .attr("width", EVzoom.matrix.cellSize)
+ .attr("height", EVzoom.matrix.cellSize);
+ EVzoom.matrix.nodes.cells[i].push(node);
+ }
+ }
+ EVzoom.matrix.nodes.iLabels = [];
+ for (var i = 0; i < 20; i++) {
+ var xshift = EVzoom.matrix.x + i * EVzoom.matrix.cellSize;
+ var yshift = EVzoom.matrix.y;
+ var node = plot.append("text")
+ .attr("id", "biC" + i)
+ .style("stroke", "none")
+ .style("fill", "gray")
+ .style("opacity", 0)
+ .style("font-size", EVzoom.matrix.fontSize)
+ .style("font-family", EVzoom.matrix.font)
+ .attr("transform", "translate(" + xshift + "," + yshift + ")")
+ .text(" ");
+ EVzoom.matrix.nodes.iLabels.push(node);
+ }
+ EVzoom.matrix.nodes.jLabels = [];
+ for (var j = 0; j < 20; j++) {
+ var xshift = EVzoom.matrix.x + 20 * EVzoom.matrix.cellSize;
+ var yshift = EVzoom.matrix.y + j * EVzoom.matrix.cellSize;
+ var node = plot.append("text")
+ .attr("id", "bjC" + j)
+ .style("stroke", "none")
+ .style("fill", "gray")
+ .style("opacity", 0)
+ .style("font-size", EVzoom.matrix.fontSize)
+ .style("font-family", EVzoom.matrix.font)
+ .attr("transform", "translate(" + xshift + "," + yshift + ") rotate(90)")
+ .text(" ");
+ EVzoom.matrix.nodes.jLabels.push(node);
+ }
+
+ // Animate couplings
+ for (var c = 0; c < couplings.length; c++) {
+ d3.select("#c" + (couplings[c].i) + "-" + (couplings[c].j))
+ .transition()
+ .attr("r", EVzoom.radiusFun(couplings[c].score))
+ .duration(600)
+ .delay(400 + 5 * Math.abs(couplings[c].i - couplings[c].j));
+ }
+}
+
+EVzoom.prepareLogo = function() {
+ // Process logo to sort into groups
+ var logo = EVzoom.logo.data;
+
+ // Tabulate group sizes
+ for (var i = 0; i < logo.length; i++) {
+ var groupSet = [];
+ var bitsSet = [];
+ var indexSet = [];
+ for (var j = 0; j < logo[i].length; j++) {
+ var code = logo[i][j].code;
+ var bits = logo[i][j].bits;
+ var group = EVzoom.aaGroups[code];
+ if (groupSet.indexOf(group) == -1) {
+ groupSet.push(group);
+ bitsSet.push(bits);
+ } else {
+ bitsSet[groupSet.indexOf(group)] += bits;
+ }
+ }
+
+ // Sort by smallest group to largest, internally by bits
+ logo[i].sort(function(a,b) {
+ var groupA = EVzoom.aaGroups[a.code];
+ var groupB = EVzoom.aaGroups[b.code];
+ var bitsA = bitsSet[groupSet.indexOf(groupA)];
+ var bitsB = bitsSet[groupSet.indexOf(groupB)];
+ if (a.code == b.code) {
+ return 0;
+ } else if (groupA == groupB) {
+ if (a.bits < b.bits) {
+ return -1;
+ } else if (a.bits > b.bits) {
+ return 1;
+ } else {
+ return 0;
+ }
+ } else if (bitsA < bitsB) {
+ return -1;
+ } else if (bitsA > bitsB) {
+ return 1;
+ } else {
+ return 0;
+ }
+ })
+ }
+}
+
+EVzoom.prepareCouplings = function() {
+ EVzoom.couplings.data.sort(function(a,b) {
+ if (a.score > b.score) {
+ return -1;
+ } else if (a.score < b.score) {
+ return 1;
+ } else {
+ return 0;
+ }
+ })
+ // Identify largest scale
+ var maxScale = 0;
+ for (var i = 0; i < EVzoom.couplings.data.length; i++) {
+ if (EVzoom.couplings.data[i].score > maxScale) {
+ maxScale = EVzoom.couplings.data[i].score;
+ }
+ }
+ // Normalize coupling scale
+ for (var i = 0; i < EVzoom.couplings.data.length; i++) {
+ EVzoom.couplings.data[i].score =
+ EVzoom.couplings.data[i].score / maxScale;
+ }
+ // Identify coupling magnitude
+ var maxCoupling = 0;
+ for (var i = 0; i < EVzoom.couplings.data.length; i++) {
+ for (var ai = 0; ai < EVzoom.couplings.data[i].matrix.length; ai++) {
+ for (var aj = 0; aj < EVzoom.couplings.data[i].matrix[ai].length; aj++) {
+ if (Math.abs(EVzoom.couplings.data[i].matrix[ai][aj]) > maxCoupling) {
+ maxCoupling = Math.abs(EVzoom.couplings.data[i].matrix[ai][aj]);
+ }
+ }
+ }
+ }
+ // Normalize coupling magnitude
+ for (var i = 0; i < EVzoom.couplings.data.length; i++) {
+ for (var ai = 0; ai < EVzoom.couplings.data[i].matrix.length; ai++) {
+ for (var aj = 0; aj < EVzoom.couplings.data[i].matrix[ai].length; aj++) {
+ EVzoom.couplings.data[i].matrix[ai][aj] =
+ EVzoom.couplings.data[i].matrix[ai][aj] / maxCoupling;
+ }
+ }
+ }
+}
+
+EVzoom.prepareData = function(data) {
+ EVzoom.couplings.data = data["couplings"];
+ EVzoom.logo.data = data["logo"];
+ EVzoom.map = data["map"];
+ console.log("Data loaded");
+ console.log(EVzoom.map)
+
+ EVzoom.prepareLogo();
+ EVzoom.prepareCouplings();
+ EVzoom.buildSVG();
+
+ // Loading timer
+ var LOAD_TIME = 700 + 5 * EVzoom.logo.data.length;
+ var loadTimer = d3.timer(function(elapsed) {
+ if (elapsed > LOAD_TIME) { EVzoom.state.viewerLoaded = 1; }
+ }, 0);
+
+ // Regularly update timer
+ setInterval(EVzoom.tick, EVzoom.times.globalTick);
+}
+
+// Initializer
+EVzoom.initialize = function() {
+ // Build the frame
+
+ // Load the data and then setup the plot
+ var url = "";
+
+ // Option 1) Obtain the data url from a div tag
+ var tags = d3.select("#evzoom-viewer");
+ if (!tags.empty()) {
+ url = tags.node()
+ .getAttribute("data-couplings");
+ }
+
+ // Option 2) Check for a query in the URL
+ var match = "";
+ var queries = /([^&=]+)=?([^&]*)/g;
+ var searchQuery = window.location.search.substring(1);
+ while (match = queries.exec(searchQuery)) {
+ if (match.length > 2 && match[1] == "data") {
+ url = match[2];
+ }
+ }
+
+ // Load the data
+ console.log("Loading " + url)
+ d3.json(url)
+ .on("progress", function() { if (d3.event != null && d3.event.hasAttribute("loaded")) console.log("progress", d3.event.loaded);})
+ .on("load", EVzoom.prepareData)
+ .on("error", function(error) { console.log("failure!", error); })
+ .get();
+}
+
+// Run EVzoom
+EVzoom.initialize();
\ No newline at end of file